SLC7A5P1 (solute carrier family 7 member 5 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 81893
Gene name Solute carrier family 7 member 5 pseudogene 1
Gene symbol SLC7A5P1
Synonyms (NCBI Gene)
DC49LAT1-3TMMLAShLAT1-3TM
Chromosome 16
Chromosome location 16p11.2
Summary This locus represents a pseudogene of the L-type amino acid transporter 1. Transcripts initiating at this locus read through to downstream SMG1 pseudogene 2 (SMG1P2). [provided by RefSeq, Feb 2016]
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
GO:0022857 Function Transmembrane transporter activity IEA
GO:0055085 Process Transmembrane transport IEA
GO:1902475 Process L-alpha-amino acid transmembrane transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8MH63
Protein name Putative L-type amino acid transporter 1-like protein MLAS (hLAT1 3-transmembrane protein MLAS) (hLAT1 3TM MLAS)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13520 AA_permease_2 50 → 179 Amino acid permease Family
Tissue specificity TISSUE SPECIFICITY: Expressed in peripheral blood mononuclear cells and lymphoid and myeloid cell lines. {ECO:0000269|PubMed:12009310}.
Sequence 
MAGAGPKRRALAAPVAEEKEEAREKMLASKRADGAAPAGEGEGVTLQRNITLLNGVAIIV
GAIIGSGIFVTPTGVLKEAGSPGLALVMWAACGVFSIVGALCYAELGTTISKSGGDYAYM
LDVYGSLPAFLKLWIELLVIRPSSQYIVALVFATYLLKPLFPSCPVPEEAAKLMACHCVH
Sequence length 180
Interactions View interactions

No strongly related genes found yet for SLC7A5P1.

No additional diseases found yet through genes similar to SLC7A5P1.