SLC7A13 (solute carrier family 7 member 13)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 157724
• Gene name: Solute carrier family 7 member 13
• Gene symbol: SLC7A13
• Synonyms (NCBI Gene): AGT-1, AGT1, XAT2
• Chromosome: 8
• Chromosome location: 8q21.3

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018744	hsa-miR-335-5p	Microarray	18185580
MIRT1367122	hsa-miR-3606	CLIP-seq
MIRT1367123	hsa-miR-3908	CLIP-seq
MIRT1367124	hsa-miR-3942-5p	CLIP-seq
MIRT1367125	hsa-miR-4325	CLIP-seq
MIRT1367126	hsa-miR-4522	CLIP-seq
MIRT1367127	hsa-miR-4703-5p	CLIP-seq
MIRT1367128	hsa-miR-4714-5p	CLIP-seq
MIRT1367129	hsa-miR-4766-3p	CLIP-seq
MIRT1367130	hsa-miR-4786-3p	CLIP-seq
MIRT1367131	hsa-miR-507	CLIP-seq
MIRT1367132	hsa-miR-557	CLIP-seq
MIRT1367133	hsa-miR-921	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003333	Process	Amino acid transmembrane transport	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006865	Process	Amino acid transport	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IBA
GO:0015297	Function	Antiporter activity	IEA
GO:0015810	Process	Aspartate transmembrane transport	IEA
GO:0015811	Process	L-cystine transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IEA

Other IDs

• MIM: 617256
• HGNC: 23092
• e!Ensembl: ENSG00000164893

Protein

• UniProt ID: Q8TCU3
• Protein name: Solute carrier family 7 member 13 (Sodium-independent aspartate/glutamate transporter 1) (X-amino acid transporter 2)
• Protein function: Associates with SLC3A1/rBAT to form a functional heterodimeric complex that transports anionic and neutral amino acids across the apical plasma membrane of renal epithelium. Preferentially mediates exchange transport, but can also operate via fa
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13520	AA_permease_2	15 → 439	Amino acid permease	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the kidney. {ECO:0000269|PubMed:11943479}.
• Sequence:

  MDRGEKIQLKRVFGYWWGTSFLLINIIGAGIFVSPKGVLAYSCMNVGVSLCVWAGCAILA
  MTSTLCSAEISISFPCSGAQYYFLKRYFGSTVAFLNLWTSLFLGSGVVAGQALLLAEYSI
  QPFFPSCSVPKLPKKCLALAMLWIVGILTSRGVKEVTWLQIASSVLKVSILSFISLTGVV
  FLIRGKKENVERFQNAFDAELPDISHLIQAIFQGYFAYSGGACFTLIAGELKKPRTTIPK
  CIFTALPLVTVVYLLVNISYLTVLTPREILSSDAVAITWADRAFPSLAWIMPFAISTSLF
  SNLLISIFKSSRPIYLASQEGQLPLLFNTLNSHSSPFTAVLLLVTLGSLAIILTSLIDLI
  NYIFFTGSLWSILLMIGILRRRYQEPNLSIPYKVFLSFPLATIVIDVGLVVIPLVKSPNV
  HYVYVLLLVLSGLLFYIPLIHFKIRLAWFEKMTCYLQLLFNICLPDVSEE

• Sequence length: 470

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (10)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Cerebrovascular accident	Stroke	GWASDB_DG	23422753		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21437271		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21437271		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21437271	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21437271		★☆☆☆☆ Found in Text Mining only
Cystinuria	Cystinuria	BEFREE	30342472		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	14997208		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	14997208		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	7926462		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	34469896	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for SLC7A13.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC7A13.