SLC75A1 (solute carrier family 75 member 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10227
• Gene name: Solute carrier family 75 member 1
• Gene symbol: SLC75A1
• Synonyms (NCBI Gene): MFSD10, TETRAN, TETTRAN
• Chromosome: 4
• Chromosome location: 4p16.3

miRNA Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004147	hsa-miR-192-5p	Microarray	16822819
MIRT022603	hsa-miR-124-3p	Microarray	18668037
MIRT023778	hsa-miR-1-3p	Proteomics	18668040
MIRT025768	hsa-miR-7-5p	Microarray	19073608
MIRT1146349	hsa-miR-153	CLIP-seq
MIRT1146350	hsa-miR-22	CLIP-seq
MIRT1146351	hsa-miR-3074-5p	CLIP-seq
MIRT1146352	hsa-miR-370	CLIP-seq
MIRT1146353	hsa-miR-4278	CLIP-seq
MIRT1146354	hsa-miR-4688	CLIP-seq
MIRT1146355	hsa-miR-490-3p	CLIP-seq
MIRT1146356	hsa-miR-516a-3p	CLIP-seq
MIRT1146357	hsa-miR-548q	CLIP-seq
MIRT1146358	hsa-miR-552	CLIP-seq
MIRT1146359	hsa-miR-558	CLIP-seq
MIRT1146360	hsa-miR-764	CLIP-seq
MIRT1146361	hsa-miR-1184	CLIP-seq
MIRT1146362	hsa-miR-122	CLIP-seq
MIRT1146363	hsa-miR-1252	CLIP-seq
MIRT1146364	hsa-miR-1264	CLIP-seq
MIRT1146365	hsa-miR-1301	CLIP-seq
MIRT1146350	hsa-miR-22	CLIP-seq
MIRT1146366	hsa-miR-2277-3p	CLIP-seq
MIRT1146367	hsa-miR-28-5p	CLIP-seq
MIRT1146368	hsa-miR-3139	CLIP-seq
MIRT1146369	hsa-miR-3198	CLIP-seq
MIRT1146370	hsa-miR-4309	CLIP-seq
MIRT1146371	hsa-miR-432	CLIP-seq
MIRT1146372	hsa-miR-4420	CLIP-seq
MIRT1146373	hsa-miR-4660	CLIP-seq
MIRT1146374	hsa-miR-5047	CLIP-seq
MIRT1146375	hsa-miR-512-3p	CLIP-seq
MIRT1146376	hsa-miR-516b	CLIP-seq
MIRT1146359	hsa-miR-558	CLIP-seq
MIRT1146377	hsa-miR-708	CLIP-seq
MIRT1146378	hsa-miR-765	CLIP-seq
MIRT1146361	hsa-miR-1184	CLIP-seq
MIRT2041706	hsa-miR-1207-5p	CLIP-seq
MIRT1146363	hsa-miR-1252	CLIP-seq
MIRT1146364	hsa-miR-1264	CLIP-seq
MIRT1146365	hsa-miR-1301	CLIP-seq
MIRT2041707	hsa-miR-1909	CLIP-seq
MIRT2041708	hsa-miR-2682	CLIP-seq
MIRT2041709	hsa-miR-2861	CLIP-seq
MIRT2041710	hsa-miR-34a	CLIP-seq
MIRT2041711	hsa-miR-34c-5p	CLIP-seq
MIRT2041712	hsa-miR-4269	CLIP-seq
MIRT1146372	hsa-miR-4420	CLIP-seq
MIRT2041713	hsa-miR-449a	CLIP-seq
MIRT2041714	hsa-miR-449b	CLIP-seq
MIRT2041715	hsa-miR-449c	CLIP-seq
MIRT2041716	hsa-miR-4514	CLIP-seq
MIRT1146373	hsa-miR-4660	CLIP-seq
MIRT2041717	hsa-miR-4692	CLIP-seq
MIRT2041718	hsa-miR-4742-5p	CLIP-seq
MIRT2041719	hsa-miR-4763-3p	CLIP-seq
MIRT1146374	hsa-miR-5047	CLIP-seq
MIRT1146375	hsa-miR-512-3p	CLIP-seq
MIRT1146351	hsa-miR-3074-5p	CLIP-seq
MIRT1146352	hsa-miR-370	CLIP-seq
MIRT1146353	hsa-miR-4278	CLIP-seq
MIRT1146354	hsa-miR-4688	CLIP-seq
MIRT1146356	hsa-miR-516a-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IEA
GO:0005637	Component	Nuclear inner membrane	IEA
GO:0005637	Component	Nuclear inner membrane	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008493	Function	Tetracycline transmembrane transporter activity	TAS	8353488
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	18638446
GO:0015904	Process	Tetracycline transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8353488
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IDA	18638446
GO:0031090	Component	Organelle membrane	IEA
GO:0031526	Component	Brush border membrane	IBA
GO:0031526	Component	Brush border membrane	IEA
GO:0043252	Process	Sodium-independent organic anion transport	IDA	18638446
GO:0055085	Process	Transmembrane transport	IEA

Other IDs

• MIM: 610977
• HGNC: 16894
• e!Ensembl: ENSG00000109736

Protein

• UniProt ID: Q14728
• Protein name: Major facilitator superfamily domain-containing protein 10 (Tetracycline transporter-like protein)
• Protein function: Probable organic anion transporter which may serve as a transporter for some non-steroidal anti-inflammatory drugs (NSAIDs) as well as other organic anions across the luminal membranes of renal proximal tubules at the final excretion step into t
• PDB: 6S4M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	28 → 412	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in luminal membrane of renal tubules (at protein level) (PubMed:18638446). Detected in all tissues tested with higher expression in heart, splee, kidney, leukocytes and prostate (PubMed:18638446). {ECO:0000269|PubMed:18638446
• Sequence:

  MGWGGGGGCTPRPPIHQQPPERRVVTVVFLGLLLDLLAFTLLLPLLPGLLESHGRAHDPL
  YGSWQGGVDWFATAIGMPVEKRYNSVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVM
  LLCLMGVATSYAVWATSRSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVI
  GVAFSLGFTLGPMLGASLPLEMAPWFALLFAASDLLFIFCFLPETLPLEKRAPSIALGFR
  DAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQR
  FQFSSLQQGKMFFLIGLTMATIQGAYARRIHPGGEVAAVKRALLLLVPAFLLIGWGRSLP
  VLGLGLLLYSFAAAVVVPCLSSVVAGYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYW
  LAGAQACFTTWSGLFLLPFFLLQKLSYPAQTLKAE

• Sequence length: 455

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Gastric cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for SLC75A1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC75A1.