SLC67A1-AS (SLC67A1 antisense RNA)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 5003 |
| Gene name | SLC67A1 antisense RNA |
| Gene symbol | SLC67A1-AS |
| Synonyms (NCBI Gene) |
BWR1BBWSCR1BORCTL2SSLC22A18ASSLC22A1LSp27-BWR1B
|
| Chromosome | 11 |
| Chromosome location | 11p15.4 |
|
miRNA
miRNA information provided by mirtarbase database.
28
|
|||||||||||||||||||||||||
|
|||||||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8N1D0 |
| Protein name | Uncharacterized protein SLC67A1-AS (Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein) (Organic cation transporter-like protein 2 antisense protein) (SLC67A1 antisense RNA) (Solute carrier family 22 member 1-like antisense protein) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Most abundantly expressed in gastrointestinal tissues. Expressed at lower levels in kidney and placenta. Expressed in fetal brain, liver, placenta, kidney and lung. {ECO:0000269|PubMed:15175115, ECO:0000269|PubMed:9520460}. |
| Sequence |
MGELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREA |
| Sequence length | 253 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with SLC67A1-AS across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to SLC67A1-AS (see Related Genes above), that are NOT already directly curated for SLC67A1-AS itself -- a lead worth checking, not a confirmed association.
0
|
|