SLC66A1LP (solute carrier family 66 member 1 like, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 152078
Gene name Solute carrier family 66 member 1 like, pseudogene
Gene symbol SLC66A1LP
Synonyms (NCBI Gene)
C3orf55PQLC2LSLC66A1LSLC66A2L
Chromosome 3
Chromosome location 3q25.32
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005765 Component Lysosomal membrane IBA
GO:0015174 Function Basic amino acid transmembrane transporter activity IEA
GO:0015189 Function L-lysine transmembrane transporter activity IBA
GO:0098852 Component Lytic vacuole membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A1A4F0
Protein name Putative uncharacterized protein SLC66A1LP (PQ-loop repeat-containing protein 2-like) (Solute carrier family 66 member 1-like)
Family and domains
Sequence 
MKVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFK
GCYLTNQLPIQIFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLS
LWGVLCPVYIPYSFR
Sequence length 135
Interactions View interactions

No strongly related genes found yet for SLC66A1LP.

No additional diseases found yet through genes similar to SLC66A1LP.