SLC5A10 (solute carrier family 5 member 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 125206
• Gene name: Solute carrier family 5 member 10
• Gene symbol: SLC5A10
• Synonyms (NCBI Gene): SGLT-5, SGLT5
• Chromosome: 17
• Chromosome location: 17p11.2
• Summary: This gene is a member of the sodium/glucose transporter family. Members of this family are sodium-dependent transporters and can be divided into two subfamilies based on sequence homology, one that co-transports sugars and the second that transports molec

miRNA Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018763	hsa-miR-335-5p	Microarray	18185580
MIRT1365319	hsa-miR-4260	CLIP-seq
MIRT1365320	hsa-miR-4713-3p	CLIP-seq
MIRT1365321	hsa-miR-635	CLIP-seq
MIRT1365319	hsa-miR-4260	CLIP-seq
MIRT1365320	hsa-miR-4713-3p	CLIP-seq
MIRT1365321	hsa-miR-635	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005412	Function	D-glucose:sodium symporter activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015370	Function	Solute:sodium symporter activity	IEA
GO:0015370	Function	Solute:sodium symporter activity	TAS
GO:0015755	Process	Fructose transmembrane transport	IEA
GO:0015761	Process	Mannose transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0140929	Function	Mannose:sodium symporter activity	IDA	22212718, 24573086
GO:0140929	Function	Mannose:sodium symporter activity	IEA
GO:0140930	Function	Fructose:sodium symporter activity	IDA	22212718, 23451068
GO:0140930	Function	Fructose:sodium symporter activity	IEA

Other IDs

• MIM: 618636
• HGNC: 23155
• e!Ensembl: ENSG00000154025

Protein

• UniProt ID: A0PJK1
• Protein name: Sodium/mannose cotransporter SLC5A10 (Sodium/glucose cotransporter 5) (Na(+)/glucose cotransporter 5) (Solute carrier family 5 member 10)
• Protein function: [Isoform 1]: Electrogenic Na+-coupled sugar symporter that actively transports D-mannose or D-fructose at the plasma membrane, with a Na+ to sugar coupling ratio of 1:1. Transporter activity is driven by a transmembrane Na+ electrochemical gradi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00474	SSF	50 → 479	Sodium:solute symporter family	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed at high levels in kidney. Very low expression is detected in testes. {ECO:0000269|PubMed:22212718}.; TISSUE SPECIFICITY: [Isoform 1]: Expressed in kidney. {ECO:0000269|PubMed:22212718}.; TISSUE SPECIFICITY: [Iso
• Sequence:

  MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGYFLAGRDMTWW
  PIGASLFASSEGSGLFIGLAGSGAAGGLAVAGFEWNATYVLLALAWVFVPIYISSEIVTL
  PEYIQKRYGGQRIRMYLSVLSLLLSVFTKISLDLYAGALFVHICLGWNFYLSTILTLGIT
  ALYTIAGGLAAVIYTDALQTLIMVVGAVILTIKAFDQIGGYGQLEAAYAQAIPSRTIANT
  TCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAG
  SILASYLKMLPMGLIIMPGMISRALFPDDVGCVVPSECLRACGAEVGCSNIAYPKLVMEL
  MPIGLRGLMIAVMLAALMSSLTSIFNSSSTLFTMDIWRRLRPRSGERELLLVGRLVIVAL
  IGVSVAWIPVLQDSNSGQLFIYMQSVTSSLAPPVTAVFVLGVFWRRANEQGAFWGLIAGL
  VVGATRLVLEFLNPAPPCGEPDTRPAVLGSIHYLHFAVALFALSGAVVVAGSLLTPPPQS
  VQIENLTWWTLAQDVPLGTKAGDGQTPQKHAFWARVCGFNAILLMCVNIFFYAYFA

• Sequence length: 596

Pathways

Reactome Pathway:

Cellular hexose transport

Related Genes

No strongly related genes found yet for SLC5A10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC5A10.