Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	85414
Gene name	Solute carrier family 45 member 3
Gene symbol	SLC45A3
Synonyms (NCBI Gene)	IPCA-2IPCA-6IPCA-8IPCA6PCANAP2PCANAP6PCANAP8PRST
Chromosome	1
Chromosome location	1q32.1

79 Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000798	hsa-miR-126-3p	Western blotLuciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Western blotLuciferase reporter assay	18193184
MIRT000797	hsa-miR-138-5p	Western blotLuciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Western blotLuciferase reporter assay	18193184
MIRT000798	hsa-miR-126-3p	Western blotLuciferase reporter assay	18193184
MIRT000797	hsa-miR-138-5p	Western blotLuciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Luciferase reporter assay	18193184
MIRT006716	hsa-miR-32-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22521588
MIRT000798	hsa-miR-126-3p	Reporter assay;Other	18193184
MIRT001820	hsa-miR-126-5p	Reporter assay;Other	18193184
MIRT000797	hsa-miR-138-5p	Reporter assay;Other	18193184
MIRT439597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT000798	hsa-miR-126-3p	MicroarrayqRT-PCR	35816043
MIRT1364494	hsa-miR-137	CLIP-seq
MIRT1364495	hsa-miR-15a	CLIP-seq
MIRT1364496	hsa-miR-15b	CLIP-seq
MIRT1364497	hsa-miR-16	CLIP-seq
MIRT1364498	hsa-miR-195	CLIP-seq
MIRT1364499	hsa-miR-208a	CLIP-seq
MIRT1364500	hsa-miR-208b	CLIP-seq
MIRT1364501	hsa-miR-2110	CLIP-seq
MIRT1364502	hsa-miR-214	CLIP-seq
MIRT1364503	hsa-miR-25	CLIP-seq
MIRT1364504	hsa-miR-3147	CLIP-seq
MIRT1364505	hsa-miR-3150a-3p	CLIP-seq
MIRT1364506	hsa-miR-3162-3p	CLIP-seq
MIRT1364507	hsa-miR-32	CLIP-seq
MIRT1364508	hsa-miR-361-3p	CLIP-seq
MIRT1364509	hsa-miR-3619-5p	CLIP-seq
MIRT1364510	hsa-miR-363	CLIP-seq
MIRT1364511	hsa-miR-367	CLIP-seq
MIRT1364512	hsa-miR-424	CLIP-seq
MIRT1364513	hsa-miR-4291	CLIP-seq
MIRT1364514	hsa-miR-4425	CLIP-seq
MIRT1364515	hsa-miR-4450	CLIP-seq
MIRT1364516	hsa-miR-4713-3p	CLIP-seq
MIRT1364517	hsa-miR-497	CLIP-seq
MIRT1364518	hsa-miR-518a-5p	CLIP-seq
MIRT1364519	hsa-miR-527	CLIP-seq
MIRT1364520	hsa-miR-761	CLIP-seq
MIRT1364521	hsa-miR-885-3p	CLIP-seq
MIRT1364522	hsa-miR-922	CLIP-seq
MIRT1364523	hsa-miR-92a	CLIP-seq
MIRT1364524	hsa-miR-92b	CLIP-seq
MIRT1920917	hsa-miR-122	CLIP-seq
MIRT1920918	hsa-miR-3659	CLIP-seq
MIRT1920919	hsa-miR-4793-5p	CLIP-seq
MIRT1920917	hsa-miR-122	CLIP-seq
MIRT1920918	hsa-miR-3659	CLIP-seq
MIRT1920919	hsa-miR-4793-5p	CLIP-seq
MIRT2108167	hsa-miR-3128	CLIP-seq
MIRT2108168	hsa-miR-3185	CLIP-seq
MIRT2108169	hsa-miR-383	CLIP-seq
MIRT2108170	hsa-miR-4699-5p	CLIP-seq
MIRT2108171	hsa-miR-4720-5p	CLIP-seq
MIRT2108172	hsa-miR-4772-5p	CLIP-seq
MIRT2108173	hsa-miR-4799-3p	CLIP-seq
MIRT2331986	hsa-miR-1271	CLIP-seq
MIRT2331987	hsa-miR-182	CLIP-seq
MIRT2331988	hsa-miR-2355-5p	CLIP-seq
MIRT2331989	hsa-miR-323-3p	CLIP-seq
MIRT2331990	hsa-miR-4738-3p	CLIP-seq
MIRT1364521	hsa-miR-885-3p	CLIP-seq
MIRT2331991	hsa-miR-96	CLIP-seq
MIRT2440544	hsa-miR-3664-5p	CLIP-seq
MIRT2440545	hsa-miR-4528	CLIP-seq
MIRT2440546	hsa-miR-4714-5p	CLIP-seq
MIRT2440544	hsa-miR-3664-5p	CLIP-seq
MIRT2440545	hsa-miR-4528	CLIP-seq
MIRT2440546	hsa-miR-4714-5p	CLIP-seq
MIRT2459765	hsa-miR-1827	CLIP-seq
MIRT2459766	hsa-miR-3130-5p	CLIP-seq
MIRT2459767	hsa-miR-3649	CLIP-seq
MIRT2459768	hsa-miR-4290	CLIP-seq
MIRT2459769	hsa-miR-4316	CLIP-seq
MIRT2459770	hsa-miR-4482	CLIP-seq
MIRT2459771	hsa-miR-711	CLIP-seq
MIRT2459772	hsa-miR-940	CLIP-seq

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence
GO:0005886	Component	Plasma membrane	TAS
GO:0008506	Function	Sucrose:proton symporter activity	IBA
GO:0008506	Function	Sucrose:proton symporter activity	IEA
GO:0008506	Function	Sucrose:proton symporter activity	ISS
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0010907	Process	Positive regulation of glucose metabolic process	IEA
GO:0010907	Process	Positive regulation of glucose metabolic process	ISS
GO:0015293	Function	Symporter activity	IEA
GO:0015770	Process	Sucrose transport	IEA
GO:0015770	Process	Sucrose transport	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	ISS
GO:0048713	Process	Regulation of oligodendrocyte differentiation	IEA
GO:0048713	Process	Regulation of oligodendrocyte differentiation	ISS
GO:0051119	Function	Sugar transmembrane transporter activity	TAS
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605097	8642	ENSG00000158715

Q96JT2

Protein name

Solute carrier family 45 member 3 (Prostate cancer-associated protein 6) (Prostein)

Protein function

Proton-associated sucrose transporter. May be able to transport also glucose and fructose.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	18 → 305	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Prostate specific. Expressed in all prostatic glandular cells. Expressed both in normal and cancerous prostates. {ECO:0000269|PubMed:11245466, ECO:0000269|PubMed:14997204}.

Sequence

MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVCVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA
IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLSPH
CCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA
AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG
ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA
RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ
VVFDKSDLAKYSA

Sequence length

553

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Transcriptional misregulation in cancer	Cellular hexose transport
MicroRNAs in cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Teratoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (21)
Adenocarcinoma	Adenocarcinoma	BEFREE	30061246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	22441574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29241741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36337169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30061246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38218896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29241741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	38218896	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11245466, 15176054, 18172298, 18193184, 19293179, 20118910, 20406994, 20526349, 22719019, 22787087, 22821757, 26959281, 27700103, 29088771, 29241741, 31290785 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29241741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22821757, 25188740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34334114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26959281, 29088771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASDB_DG	22438815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11245466, 15176054, 18172298, 18193184, 19293179, 20118910, 22719019, 22787087, 22821757, 26959281, 27700103, 29088771, 29241741, 31290785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11245466, 17671502, 18542058, 20406994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18172298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18193184, 19293179, 19649210, 20406994, 20526349, 21178489, 24925052, 27700103, 28235401, 28467780, 32753032, 38017230, 38218896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	38218896	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Cord-Stromal Tumor	Sex Cord-Stromal Tumor	BEFREE	31498176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33762601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with SLC45A3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SLC45A3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SLC45A3 (see Related Genes above), that are NOT already directly curated for SLC45A3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SLC45A3.

SLC45A3 (solute carrier family 45 member 3)

Bookmark This Gene