Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	29986
Gene name	Solute carrier family 39 member 2
Gene symbol	SLC39A2
Synonyms (NCBI Gene)	6A1ETI-1ZIP-2ZIP2
Chromosome	14
Chromosome location	14q11.2
Summary	This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease. Multiple transcript variants have been des

37 Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018258	hsa-miR-335-5p	Microarray	18185580
MIRT495503	hsa-miR-6858-3p	PAR-CLIP	22291592
MIRT495502	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495501	hsa-miR-1915-3p	PAR-CLIP	22291592
MIRT495500	hsa-miR-6764-5p	PAR-CLIP	22291592
MIRT495499	hsa-miR-3194-5p	PAR-CLIP	22291592
MIRT495498	hsa-miR-6069	PAR-CLIP	22291592
MIRT495503	hsa-miR-6858-3p	PAR-CLIP	22291592
MIRT495502	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495501	hsa-miR-1915-3p	PAR-CLIP	22291592
MIRT495500	hsa-miR-6764-5p	PAR-CLIP	22291592
MIRT495499	hsa-miR-3194-5p	PAR-CLIP	22291592
MIRT495498	hsa-miR-6069	PAR-CLIP	22291592
MIRT2626175	hsa-miR-3689a-3p	CLIP-seq
MIRT2626176	hsa-miR-3689c	CLIP-seq
MIRT2626177	hsa-miR-3976	CLIP-seq
MIRT2626178	hsa-miR-4287	CLIP-seq
MIRT2626179	hsa-miR-4292	CLIP-seq
MIRT2626180	hsa-miR-4308	CLIP-seq
MIRT2626181	hsa-miR-4450	CLIP-seq
MIRT2626182	hsa-miR-4469	CLIP-seq
MIRT2626183	hsa-miR-4667-5p	CLIP-seq
MIRT2626184	hsa-miR-4685-3p	CLIP-seq
MIRT2626185	hsa-miR-4700-5p	CLIP-seq
MIRT2626186	hsa-miR-4728-5p	CLIP-seq
MIRT2626175	hsa-miR-3689a-3p	CLIP-seq
MIRT2626176	hsa-miR-3689c	CLIP-seq
MIRT2626177	hsa-miR-3976	CLIP-seq
MIRT2626178	hsa-miR-4287	CLIP-seq
MIRT2626179	hsa-miR-4292	CLIP-seq
MIRT2626180	hsa-miR-4308	CLIP-seq
MIRT2626181	hsa-miR-4450	CLIP-seq
MIRT2626182	hsa-miR-4469	CLIP-seq
MIRT2626183	hsa-miR-4667-5p	CLIP-seq
MIRT2626184	hsa-miR-4685-3p	CLIP-seq
MIRT2626185	hsa-miR-4700-5p	CLIP-seq
MIRT2626186	hsa-miR-4728-5p	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IDA	29791142
GO:0005385	Function	Zinc ion transmembrane transporter activity	IEA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IMP	20148757
GO:0005385	Function	Zinc ion transmembrane transporter activity	TAS	10681536
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20148757, 30914478
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10681536
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0006829	Process	Zinc ion transport	IEA
GO:0006829	Process	Zinc ion transport	TAS	10681536
GO:0016020	Component	Membrane	IEA
GO:0030001	Process	Metal ion transport	IEA
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0046873	Function	Metal ion transmembrane transporter activity	IDA	29791142
GO:0046873	Function	Metal ion transmembrane transporter activity	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070574	Process	Cadmium ion transmembrane transport	IDA	29791142
GO:0071577	Process	Zinc ion transmembrane transport	IBA
GO:0071577	Process	Zinc ion transmembrane transport	IDA	29791142
GO:0071577	Process	Zinc ion transmembrane transport	IEA
GO:0071577	Process	Zinc ion transmembrane transport	TAS

MIM	HGNC	e!Ensembl
612166	17127	ENSG00000165794

Q9NP94

Protein name

Zinc transporter ZIP2 (6A1) (Eti-1) (Solute carrier family 39 member 2) (Zrt- and Irt-like protein 2) (ZIP-2) (hZIP2)

Protein function

Transporter for the divalent cation Zn(2+) (PubMed:10681536, PubMed:29791142, PubMed:30914478). Mediates the influx of Zn(2+) into cells from extracellular space. The Zn(2+) uniporter activity is independent of H(+)-driving force, but is modulat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02535	Zip	5 → 306	ZIP Zinc transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed only in prostate and uterine epithelial cells. {ECO:0000269|PubMed:10681536}.

Sequence

MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAG
FMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE
SLALQCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEG
LAVGLQPTVAATVQLCLAVLAHKGLVVFGVGMRLVHLGTSSRWAVFSILLLALMSPLGLA
VGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPRELASPEAPLAKWSCVAAGFA
FMAFIALWA

Sequence length

309

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Alzheimer disease	Zinc influx into cells by the SLC39 gene family
Parkinson disease

SLC39A2 (solute carrier family 39 member 2)

Bookmark This Gene