SLC38A4 (solute carrier family 38 member 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55089
• Gene name: Solute carrier family 38 member 4
• Gene symbol: SLC38A4
• Synonyms (NCBI Gene): ATA3, NAT3, PAAT, SNAT4
• Chromosome: 12
• Chromosome location: 12q13.11
• Summary: SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent (Hatanaka et a

miRNA Show/Hide all (84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017627	hsa-miR-335-5p	Microarray	18185580
MIRT486568	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT486567	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT486566	hsa-miR-4784	PAR-CLIP	23592263
MIRT486565	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT486564	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT486563	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT486562	hsa-miR-1255a	PAR-CLIP	23592263
MIRT486561	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT486560	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT486559	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT486557	hsa-miR-3153	PAR-CLIP	23592263
MIRT486558	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT486556	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT486555	hsa-miR-4689	PAR-CLIP	23592263
MIRT486554	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT486568	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT486567	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT486566	hsa-miR-4784	PAR-CLIP	23592263
MIRT486565	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT486564	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT486563	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT486562	hsa-miR-1255a	PAR-CLIP	23592263
MIRT486561	hsa-miR-1255b-5p	PAR-CLIP	23592263
MIRT486560	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT486559	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT486557	hsa-miR-3153	PAR-CLIP	23592263
MIRT486558	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT486556	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT486555	hsa-miR-4689	PAR-CLIP	23592263
MIRT486554	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT1363009	hsa-miR-3064-3p	CLIP-seq
MIRT1363010	hsa-miR-4685-5p	CLIP-seq
MIRT1363011	hsa-miR-4715-3p	CLIP-seq
MIRT1363012	hsa-miR-4733-3p	CLIP-seq
MIRT1363013	hsa-miR-4776-3p	CLIP-seq
MIRT1363014	hsa-miR-3674	CLIP-seq
MIRT1363015	hsa-miR-3935	CLIP-seq
MIRT1363016	hsa-miR-4719	CLIP-seq
MIRT1363017	hsa-miR-4793-5p	CLIP-seq
MIRT1363018	hsa-miR-541	CLIP-seq
MIRT1363019	hsa-miR-578	CLIP-seq
MIRT1363020	hsa-miR-643	CLIP-seq
MIRT1363021	hsa-miR-654-5p	CLIP-seq
MIRT2107660	hsa-miR-3143	CLIP-seq
MIRT2107661	hsa-miR-4502	CLIP-seq
MIRT2107662	hsa-miR-4762-3p	CLIP-seq
MIRT2107663	hsa-miR-543	CLIP-seq
MIRT2331493	hsa-miR-141	CLIP-seq
MIRT2331494	hsa-miR-200a	CLIP-seq
MIRT2331495	hsa-miR-224	CLIP-seq
MIRT2107660	hsa-miR-3143	CLIP-seq
MIRT2331496	hsa-miR-3926	CLIP-seq
MIRT2107661	hsa-miR-4502	CLIP-seq
MIRT2331497	hsa-miR-4694-3p	CLIP-seq
MIRT1363016	hsa-miR-4719	CLIP-seq
MIRT2331498	hsa-miR-4742-3p	CLIP-seq
MIRT2107662	hsa-miR-4762-3p	CLIP-seq
MIRT2331499	hsa-miR-522	CLIP-seq
MIRT2107663	hsa-miR-543	CLIP-seq
MIRT2331500	hsa-miR-548s	CLIP-seq
MIRT2459743	hsa-miR-3065-3p	CLIP-seq
MIRT2107660	hsa-miR-3143	CLIP-seq
MIRT2459744	hsa-miR-3170	CLIP-seq
MIRT2459745	hsa-miR-4307	CLIP-seq
MIRT2459746	hsa-miR-520d-5p	CLIP-seq
MIRT2459747	hsa-miR-524-5p	CLIP-seq
MIRT2107663	hsa-miR-543	CLIP-seq
MIRT2459748	hsa-miR-576-3p	CLIP-seq
MIRT2107661	hsa-miR-4502	CLIP-seq
MIRT2107662	hsa-miR-4762-3p	CLIP-seq
MIRT2691189	hsa-miR-1184	CLIP-seq
MIRT2691190	hsa-miR-1205	CLIP-seq
MIRT2691191	hsa-miR-1238	CLIP-seq
MIRT2691192	hsa-miR-3158-5p	CLIP-seq
MIRT2691193	hsa-miR-3182	CLIP-seq
MIRT2691194	hsa-miR-3665	CLIP-seq
MIRT2691195	hsa-miR-3673	CLIP-seq
MIRT2691196	hsa-miR-4490	CLIP-seq
MIRT2691197	hsa-miR-544	CLIP-seq
MIRT2691198	hsa-miR-550a	CLIP-seq
MIRT2691199	hsa-miR-657	CLIP-seq
MIRT2691200	hsa-miR-764	CLIP-seq
MIRT2691201	hsa-miR-9	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003333	Process	Amino acid transmembrane transport	IBA
GO:0005283	Function	Amino acid:sodium symporter activity	IDA	33928121
GO:0005295	Function	Neutral L-amino acid:sodium symporter activity	IDA	11342143, 11414754, 19015196
GO:0005295	Function	Neutral L-amino acid:sodium symporter activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006865	Process	Amino acid transport	IEA
GO:0006865	Process	Amino acid transport	TAS
GO:0015171	Function	Amino acid transmembrane transporter activity	IEA
GO:0015171	Function	Amino acid transmembrane transporter activity	TAS
GO:0015179	Function	L-amino acid transmembrane transporter activity	IBA
GO:0015293	Function	Symporter activity	IEA
GO:0015655	Function	Alanine:sodium symporter activity	IDA	11414754
GO:0015804	Process	Neutral amino acid transport	IDA	11342143, 11414754, 19015196, 33928121
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0031528	Component	Microvillus membrane	IDA	19015196
GO:0031528	Component	Microvillus membrane	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0042995	Component	Cell projection	IEA
GO:0061459	Function	L-arginine transmembrane transporter activity	IEA
GO:1903826	Process	L-arginine transmembrane transport	IEA
GO:1904273	Process	L-alanine import across plasma membrane	IDA	11414754
GO:1904273	Process	L-alanine import across plasma membrane	IEA
GO:1904557	Process	L-alanine transmembrane transport	IEA

Other IDs

• MIM: 608065
• HGNC: 14679
• e!Ensembl: ENSG00000139209

Protein

• UniProt ID: Q969I6
• Protein name: Sodium-coupled neutral amino acid transporter 4 (Amino acid transporter A3) (Na(+)-coupled neutral amino acid transporter 4) (Solute carrier family 38 member 4) (System A amino acid transporter 3) (System N amino acid transporter 3)
• Protein function: Symporter that cotransports neutral amino acids and sodium ions from the extraccellular to the intracellular side of the cell membrane (PubMed:11342143, PubMed:19015196, PubMed:33928121). The transport is electrogenic, pH dependent and partially
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01490	Aa_trans	304 → 535	Transmembrane amino acid transporter protein	Family
  PF01490	Aa_trans	73 → 250	Transmembrane amino acid transporter protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed almost exclusively in embryonic and adult liver, and at lower levels in the kidney (PubMed:11342143, PubMed:11414754). Expressed at lower levels in adult muscle and pancreas (PubMed:11414754). Detected in fetal blood vessels
• Sequence:

  MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGK
  KKLADYADEHHPGTTSFGMSSFNLSNAIMGSGILGLSYAMANTGIILFIIMLLAVAILSL
  YSVHLLLKTAKEGGSLIYEKLGEKAFGWPGKIGAFVSITMQNIGAMSSYLFIIKYELPEV
  IRAFMGLEENTGEWYLNGNYLIIFVSVGIILPLSLLKNLGYLGYTSGFSLTCMVFFVSVV
  IYKKFQIPCPLPVLDHSVGNLSFNNTLPMHVVMLPNNSESSDVNFMMDYTHRNPAGLDEN
  QAKGSLHDSGVEYEAHSDDKCEPKYFVFNSRTAYAIPILVFAFVCHPEVLPIYSELKDRS
  RRKMQTVSNISITGMLVMYLLAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVL
  VAVTLTVPIVLFPIRTSVITLLFPKRPFSWIRHFLIAAVLIALNNVLVILVPTIKYIFGF
  IGASSATMLIFILPAVFYLKLVKKETFRSPQKVGALIFLVVGIFFMIGSMALIIIDWIYD
  PPNSKHH

• Sequence length: 547

Pathways

Reactome Pathway:

Amino acid transport across the plasma membrane

Related Genes

No strongly related genes found yet for SLC38A4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC38A4.