SLC35G5 (solute carrier family 35 member G5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 83650
Gene name Solute carrier family 35 member G5
Gene symbol SLC35G5
Synonyms (NCBI Gene)
AMACAMAC1L2
Chromosome 8
Chromosome location 8p23.1
Summary This gene is intronless and probably arose from retrotransposition of a similar gene. It has high sequence similarity to the gene encoding acyl-malonyl condensing enzyme on chromosome 17. [provided by RefSeq, Aug 2011]
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0016020 Component Membrane IBA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615199 15546 ENSG00000177710
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96KT7
Protein name Solute carrier family 35 member G5 (Acyl-malonyl-condensing enzyme 1-like protein 2)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta and testis. {ECO:0000269|PubMed:17101974}.
Sequence 
MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGATNGLLVALLGGGLPAGFVGPLSRM
AYQGSNLPSLELLICRCLFHLPIALLLKLRGDPLLGPPDIRGWACFCALLNVLSIGCAYS
AVQVVPAGNAATVRKGSSTVCSAVLTLCLESQGLGGYEWCGLLGSILGLIIILGPGLWTL
QEGTTGVYTTLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGCVPGLFV
LQTPVLPSDLLSWSCVGAEGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYM
LHETVALSDIMGAGVVLGSIAIITARNLSCERTGKVEE
Sequence length 338
Interactions View interactions

No strongly related genes found yet for SLC35G5.

No additional diseases found yet through genes similar to SLC35G5.