SLC35E2A (solute carrier family 35 member E2A (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 9906
Gene name Solute carrier family 35 member E2A (pseudogene)
Gene symbol SLC35E2A
Synonyms (NCBI Gene)
SLC35E2SLC35E2APSLC35E2P
Chromosome 1
Chromosome location 1p36.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005794 Component Golgi apparatus IBA
GO:0015297 Function Antiporter activity IBA
GO:0016020 Component Membrane IEA
GO:0055085 Process Transmembrane transport IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 20863 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CK97
Protein name Solute carrier family 35 member E2A
Protein function Putative transporter.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03151 TPT 73 → 199 Triose-phosphate Transporter family Family
Sequence 
MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITE
TTVIESDLGVWSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGC
VKTLVPCCLYQHKARLSYPPNFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAP
IFTVIMSRMILGEYTGRPSDREEREELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP
GDFQVPQALHRVALSMALPCPMLPAS
Sequence length 266
Interactions View interactions

No strongly related genes found yet for SLC35E2A.

No additional diseases found yet through genes similar to SLC35E2A.