SLC35D3 (solute carrier family 35 member D3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 340146
• Gene name: Solute carrier family 35 member D3
• Gene symbol: SLC35D3
• Synonyms (NCBI Gene): FRCL1
• Chromosome: 6
• Chromosome location: 6q23.3

miRNA Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2331006	hsa-miR-125a-3p	CLIP-seq
MIRT2331007	hsa-miR-125a-5p	CLIP-seq
MIRT2331008	hsa-miR-125b	CLIP-seq
MIRT2331009	hsa-miR-302a	CLIP-seq
MIRT2331010	hsa-miR-302b	CLIP-seq
MIRT2331011	hsa-miR-302c	CLIP-seq
MIRT2331012	hsa-miR-302d	CLIP-seq
MIRT2331013	hsa-miR-302e	CLIP-seq
MIRT2331014	hsa-miR-3140-5p	CLIP-seq
MIRT2331015	hsa-miR-324-5p	CLIP-seq
MIRT2331016	hsa-miR-3545-3p	CLIP-seq
MIRT2331017	hsa-miR-372	CLIP-seq
MIRT2331018	hsa-miR-373	CLIP-seq
MIRT2331019	hsa-miR-3934	CLIP-seq
MIRT2331020	hsa-miR-4319	CLIP-seq
MIRT2331021	hsa-miR-4732-3p	CLIP-seq
MIRT2331022	hsa-miR-512-3p	CLIP-seq
MIRT2331023	hsa-miR-520a-3p	CLIP-seq
MIRT2331024	hsa-miR-520b	CLIP-seq
MIRT2331025	hsa-miR-520c-3p	CLIP-seq
MIRT2331026	hsa-miR-520d-3p	CLIP-seq
MIRT2331027	hsa-miR-520e	CLIP-seq
MIRT2331028	hsa-miR-626	CLIP-seq
MIRT2331029	hsa-miR-670	CLIP-seq
MIRT2331030	hsa-miR-764	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005460	Function	UDP-glucose transmembrane transporter activity	IDA	34269178
GO:0005460	Function	UDP-glucose transmembrane transporter activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0015297	Function	Antiporter activity	IBA
GO:0015786	Process	UDP-glucose transmembrane transport	IDA	34269178
GO:0015786	Process	UDP-glucose transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IDA	34269178
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0032527	Process	Protein exit from endoplasmic reticulum	IEA
GO:0045202	Component	Synapse	IEA
GO:0055085	Process	Transmembrane transport	IBA
GO:0060155	Process	Platelet dense granule organization	IEA
GO:0060155	Process	Platelet dense granule organization	ISS
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	IEA
GO:0097009	Process	Energy homeostasis	IEA

Other IDs

• MIM: 612519
• HGNC: 15621
• e!Ensembl: ENSG00000182747

Protein

• UniProt ID: Q5M8T2
• Protein name: Solute carrier family 35 member D3 (Fringe connection-like protein 1)
• Protein function: Probable UDP-glucose transmembrane transporter involved in UDP-glucose transport from the cytosol to the lumen of synaptic vesicles (PubMed:34269178). It is involved in platelet dense granules maturation (By similarity). {ECO:0000250|UniProtKB:Q
• Sequence:

  MRQLCRGRVLGISVAIAHGVFSGSLNILLKFLISRYQFSFLTLVQCLTSSTAALSLELLR
  RLGLIAVPPFGLSLARSFAGVAVLSTLQSSLTLWSLRGLSLPMYVVFKRCLPLVTMLIGV
  LVLKNGAPSPGVLAAVLITTCGAALAGAGDLTGDPIGYVTGVLAVLVHAAYLVLIQKASA
  DTEHGPLTAQYVIAVSATPLLVICSFASTDSIHAWTFPGWKDPAMVCIFVACILIGCAMN
  FTTLHCTYINSAVTTSFVGVVKSIATITVGMVAFSDVEPTSLFIAGVVVNTLGSIIYCVA
  KFMETRKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESR
  QEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYMKKDYLIENEELPSP

• Sequence length: 416

Related Genes

No strongly related genes found yet for SLC35D3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC35D3.