SLC2A7 (solute carrier family 2 member 7)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 155184
• Gene name: Solute carrier family 2 member 7
• Gene symbol: SLC2A7
• Synonyms (NCBI Gene): GLUT-7, GLUT7, hGLUT7
• Chromosome: 1
• Chromosome location: 1p36.23
• Summary: SLC2A7 belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion (Li et al., 2004). This family of transporters shows conservation of 12 transmembrane helices as well as functionally significant amino acid residu

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005353	Function	Fructose transmembrane transporter activity	IDA	28083649
GO:0005353	Function	Fructose transmembrane transporter activity	IDA	29548810
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28083649
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015755	Process	Fructose transmembrane transport	IDA	28083649
GO:0015755	Process	Fructose transmembrane transport	IDA	29548810
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0046323	Process	D-glucose import	IBA
GO:0051119	Function	Sugar transmembrane transporter activity	TAS
GO:0055056	Function	D-glucose transmembrane transporter activity	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	28083649
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	29548810
GO:0055085	Process	Transmembrane transport	IEA
GO:0070837	Process	Dehydroascorbic acid transport	IBA
GO:1904659	Process	D-glucose transmembrane transport	IDA	28083649
GO:1904659	Process	D-glucose transmembrane transport	IDA	29548810

Other IDs

• MIM: 610371
• HGNC: 13445
• e!Ensembl: ENSG00000197241

Protein

• UniProt ID: Q6PXP3
• Protein name: Solute carrier family 2, facilitated glucose transporter member 7 (Glucose transporter type 7) (GLUT-7) (hGLUT7)
• Protein function: Probable sugar transporter (PubMed:28083649). Even if its physiological substrate is subject to discussion, it is able to transport glucose and fructose (PubMed:16186102, PubMed:28083649, PubMed:29548810). Does not transport galactose, 2-deoxy-d
• PDB: 9J2N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	26 → 481	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in small intestine and colon (PubMed:15033637). Weakly expressed in testis and prostate (PubMed:15033637). {ECO:0000269|PubMed:15033637}.
• Sequence:

  MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
  FERHATFMDGKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAI
  LMGVSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGV
  FLAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQAL
  RRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLRWQLLSIIVLMAGQQLSGIN
  AINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGS
  ACLVLTVVLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMV
  DGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRI
  FAKRNRVKLPEEKEETIDAGPPTASPAKETSF

• Sequence length: 512

Pathways

Reactome Pathway:

Cellular hexose transport

Related Genes

No strongly related genes found yet for SLC2A7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC2A7.