Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6517
Gene name	Solute carrier family 2 member 4
Gene symbol	SLC2A4
Synonyms (NCBI Gene)	GLUT4
Chromosome	17
Chromosome location	17p13.1
Summary	This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is seque

337

Show/Hide all (337)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006559	hsa-miR-223-3p	FlowImmunoblotImmunofluorescenceImmunohistochemistryImmunoprecipitaionIn situ hybridizationLuciferase reporter assayNorthern blotqRT-PCR	20080987
MIRT019111	hsa-miR-335-5p	Microarray	18185580
MIRT038921	hsa-miR-92a-1-5p	CLASH	23622248
MIRT053085	hsa-miR-93-5p	Luciferase reporter assayqRT-PCRWestern blot	23493574
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT467784	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT467783	hsa-miR-1321	PAR-CLIP	23592263
MIRT467781	hsa-miR-4739	PAR-CLIP	23592263
MIRT467782	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT467780	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT467779	hsa-miR-4436a	PAR-CLIP	23592263
MIRT467778	hsa-miR-5000-3p	PAR-CLIP	23592263
MIRT467777	hsa-miR-4419a	PAR-CLIP	23592263
MIRT467776	hsa-miR-4510	PAR-CLIP	23592263
MIRT467775	hsa-miR-6127	PAR-CLIP	23592263
MIRT467774	hsa-miR-6129	PAR-CLIP	23592263
MIRT467773	hsa-miR-6130	PAR-CLIP	23592263
MIRT467772	hsa-miR-6133	PAR-CLIP	23592263
MIRT467771	hsa-miR-1286	PAR-CLIP	23592263
MIRT467770	hsa-miR-6077	PAR-CLIP	23592263
MIRT467769	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT467768	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT467766	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT467767	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	27418678
MIRT611339	hsa-miR-548ac	HITS-CLIP	27418678
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	27418678
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	27418678
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	27418678
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	27418678
MIRT611335	hsa-miR-548z	HITS-CLIP	27418678
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	27418678
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT467784	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT467783	hsa-miR-1321	PAR-CLIP	23592263
MIRT467781	hsa-miR-4739	PAR-CLIP	23592263
MIRT467782	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT467780	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT467779	hsa-miR-4436a	PAR-CLIP	23592263
MIRT467778	hsa-miR-5000-3p	PAR-CLIP	23592263
MIRT467777	hsa-miR-4419a	PAR-CLIP	23592263
MIRT467776	hsa-miR-4510	PAR-CLIP	23592263
MIRT467775	hsa-miR-6127	PAR-CLIP	23592263
MIRT467774	hsa-miR-6129	PAR-CLIP	23592263
MIRT467773	hsa-miR-6130	PAR-CLIP	23592263
MIRT467772	hsa-miR-6133	PAR-CLIP	23592263
MIRT467771	hsa-miR-1286	PAR-CLIP	23592263
MIRT467770	hsa-miR-6077	PAR-CLIP	23592263
MIRT467769	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT467768	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT467766	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT467767	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT1358879	hsa-miR-1203	CLIP-seq
MIRT1358880	hsa-miR-149	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358882	hsa-miR-2114	CLIP-seq
MIRT1358883	hsa-miR-24	CLIP-seq
MIRT1358884	hsa-miR-3064-5p	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT1358886	hsa-miR-3163	CLIP-seq
MIRT1358887	hsa-miR-3622b-5p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358892	hsa-miR-410	CLIP-seq
MIRT1358893	hsa-miR-4268	CLIP-seq
MIRT1358894	hsa-miR-4284	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358903	hsa-miR-4722-5p	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358905	hsa-miR-4755-3p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT1358908	hsa-miR-4787-3p	CLIP-seq
MIRT1358909	hsa-miR-4794	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358911	hsa-miR-548c-3p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT2106259	hsa-miR-1273	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2106260	hsa-miR-3156-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT2106261	hsa-miR-4251	CLIP-seq
MIRT2106262	hsa-miR-4252	CLIP-seq
MIRT2106263	hsa-miR-4301	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT2106264	hsa-miR-4486	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT2106265	hsa-miR-4649-5p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT2106266	hsa-miR-4793-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT2106267	hsa-miR-539	CLIP-seq
MIRT2106268	hsa-miR-661	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358879	hsa-miR-1203	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358882	hsa-miR-2114	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2330576	hsa-miR-3192	CLIP-seq
MIRT2330577	hsa-miR-361-3p	CLIP-seq
MIRT1358887	hsa-miR-3622b-5p	CLIP-seq
MIRT2330578	hsa-miR-3679-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT2330579	hsa-miR-3934	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT2330580	hsa-miR-4662a-5p	CLIP-seq
MIRT2330581	hsa-miR-4676-5p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358903	hsa-miR-4722-5p	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358908	hsa-miR-4787-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT2330582	hsa-miR-490-3p	CLIP-seq
MIRT2330583	hsa-miR-575	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358879	hsa-miR-1203	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358882	hsa-miR-2114	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2624679	hsa-miR-3613-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT2624680	hsa-miR-371-5p	CLIP-seq
MIRT2624681	hsa-miR-371b-5p	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT1358908	hsa-miR-4787-3p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358911	hsa-miR-548c-3p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq
MIRT1358881	hsa-miR-1827	CLIP-seq
MIRT1358885	hsa-miR-3122	CLIP-seq
MIRT2624679	hsa-miR-3613-3p	CLIP-seq
MIRT1358888	hsa-miR-3689a-3p	CLIP-seq
MIRT1358889	hsa-miR-3689c	CLIP-seq
MIRT2624680	hsa-miR-371-5p	CLIP-seq
MIRT2624681	hsa-miR-371b-5p	CLIP-seq
MIRT1358890	hsa-miR-3913-5p	CLIP-seq
MIRT1358891	hsa-miR-3929	CLIP-seq
MIRT1358895	hsa-miR-4419b	CLIP-seq
MIRT1358896	hsa-miR-4433	CLIP-seq
MIRT1358897	hsa-miR-4459	CLIP-seq
MIRT1358898	hsa-miR-4478	CLIP-seq
MIRT1358899	hsa-miR-4514	CLIP-seq
MIRT1358900	hsa-miR-4649-3p	CLIP-seq
MIRT1358901	hsa-miR-4683	CLIP-seq
MIRT1358902	hsa-miR-4692	CLIP-seq
MIRT1358904	hsa-miR-4728-5p	CLIP-seq
MIRT1358906	hsa-miR-4768-3p	CLIP-seq
MIRT1358907	hsa-miR-4786-5p	CLIP-seq
MIRT1358910	hsa-miR-485-5p	CLIP-seq
MIRT1358911	hsa-miR-548c-3p	CLIP-seq
MIRT1358912	hsa-miR-940	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
HDAC4	Unknown	23899560
HDAC5	Repression	22991226
HDAC5	Unknown	23899560
MEF2A	Activation	14630949;18198354
MEF2A	Unknown	15294043
PPARG	Repression	16670091
SLC2A4RG	Activation	14630949

Show/Hide all (83)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19478182, 25910212, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005771	Component	Multivesicular body	IEA
GO:0005802	Component	Trans-Golgi network	IDA	12467732
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	31112275
GO:0005886	Component	Plasma membrane	IDA	12556481, 19590752
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	2649253
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	2649253
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0007614	Process	Short-term memory	IEA
GO:0007614	Process	Short-term memory	ISS
GO:0007616	Process	Long-term memory	IEA
GO:0007616	Process	Long-term memory	ISS
GO:0009897	Component	External side of plasma membrane	IDA	14562105
GO:0009986	Component	Cell surface	IEA
GO:0010021	Process	Amylopectin biosynthetic process	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0012505	Component	Endomembrane system	ISS
GO:0012506	Component	Vesicle membrane	IDA	14562105
GO:0015304	Function	D-glucose uniporter activity	IEA
GO:0015304	Function	D-glucose uniporter activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2649253
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030136	Component	Clathrin-coated vesicle	IDA	19478182
GO:0030140	Component	Trans-Golgi network transport vesicle	IEA
GO:0030315	Component	T-tubule	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	ISS
GO:0031550	Process	Positive regulation of brain-derived neurotrophic factor receptor signaling pathway	IEA
GO:0031550	Process	Positive regulation of brain-derived neurotrophic factor receptor signaling pathway	ISS
GO:0031982	Component	Vesicle	IEA
GO:0032593	Component	Insulin-responsive compartment	IDA	19590752
GO:0032593	Component	Insulin-responsive compartment	IEA
GO:0032593	Component	Insulin-responsive compartment	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IBA
GO:0032869	Process	Cellular response to insulin stimulus	IDA	12556481
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042383	Component	Sarcolemma	ISS
GO:0042593	Process	Glucose homeostasis	IDA	14562105
GO:0042593	Process	Glucose homeostasis	IDA	17003346
GO:0044381	Process	Glucose import in response to insulin stimulus	IEA
GO:0044381	Process	Glucose import in response to insulin stimulus	IEA
GO:0044381	Process	Glucose import in response to insulin stimulus	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0046323	Process	D-glucose import	IBA
GO:0046323	Process	D-glucose import	IEA
GO:0046323	Process	D-glucose import	NAS	11742412
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12556481, 14562105, 19590752
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	25004245
GO:0055056	Function	D-glucose transmembrane transporter activity	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	ISS
GO:0055056	Function	D-glucose transmembrane transporter activity	TAS	2649253
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	IEA
GO:0070343	Process	White fat cell proliferation	ISS	36228616
GO:0070837	Process	Dehydroascorbic acid transport	IBA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071470	Process	Cellular response to osmotic stress	IEA
GO:0098694	Process	Regulation of synaptic vesicle budding from presynaptic endocytic zone membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1904659	Process	D-glucose transmembrane transport	IEA
GO:1904659	Process	D-glucose transmembrane transport	IEA
GO:1904659	Process	D-glucose transmembrane transport	ISS
GO:1904659	Process	D-glucose transmembrane transport	TAS	2649253, 12556481

MIM	HGNC	e!Ensembl
138190	11009	ENSG00000181856

P14672

Protein name

Solute carrier family 2, facilitated glucose transporter member 4 (Glucose transporter type 4, insulin-responsive) (GLUT-4)

Protein function

Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation. Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracel

PDB

7WSM , 7WSN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	27 → 483	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Skeletal and cardiac muscles; brown and white fat.

Sequence

MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND

Sequence length

509

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 2 diabetes mellitus	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (161)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	24055495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	12414908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	24055495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	24055495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	24055495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	24055495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29070572		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26295369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24931902, 31002200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10950817, 34488531, 34525987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33570246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	22028857	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	32455814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	16307905, 18256305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16307905, 30290074, 31572181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25596527, 30246639, 31607907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Centronuclear myopathy	Centronuclear Myopathy	BEFREE	28676641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28459862, 30429087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24828872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18635880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	17448565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10806301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26735579, 29504525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29504525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19720047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27453294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21645024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35468725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	31261961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31782099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11052966, 11246879, 1569156, 17107852, 17448565, 1999488, 21604201, 22466288, 23041416, 2354749, 24157451, 28450454, 28529958, 28853753, 28925477 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27981520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30805369, 35532201, 35712865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11052966, 11246879, 1569156, 17107852, 17448565, 1999488, 21604201, 22466288, 23041416, 2354749, 24157451, 28450454, 28529958, 28853753, 28925477 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16538490, 17107852, 28973736, 34360895, 37158952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20602301, 27981520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37174649	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	28973736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	1918382, 20625434, 21796809, 22673408, 29382080, 30805369, 32851733, 33989714, 37520260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19816414, 1999488, 22114711, 28944847, 32455814, 35363363	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20602301	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1521731, 1547918, 1569156, 27981520, 28034463, 28973736, 7868815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10952468, 11334434, 12079888, 1301912, 1348023, 1348045, 1499871, 1521731, 1535055, 1547918, 1559408, 16096283, 16644684, 17317207, 1756912 View all (62 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	11947963, 17107852, 22384078		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	UNIPROT_DG	1521731, 1756912, 1918382		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36792603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29686650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	30049187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29432804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	31588962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22351475, 26437953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24412827, 30662514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	24055495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26442469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	26932421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28946182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	22381410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22381410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	22381410, 34218261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type V	Glycogen Storage Disease	BEFREE	18067156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type V	Glycogen Storage Disease	LHGDN	18067156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28034463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19118529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	19118529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	17437443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	1482748, 15578099, 21105694, 25215442, 25596527, 27842906, 28759152, 28793909, 29459024, 29516429, 29683271, 30205799, 30304967, 30314325, 30841444 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	22937169	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10395191, 11287353, 15284204, 15292352, 15576451, 21646544, 21883748, 23259700, 23341487, 24932807, 25215442, 28271502, 28729437, 29183784, 30955508, 31112275, 31164724, 7868815, 8063042 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	35363363	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	16096283, 25693659, 28500736, 29130531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	16096283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24410986	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	28750406, 9240761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	LHGDN	18299470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	11278795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	LHGDN	12064911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	17416968, 28069424, 28570686, 28591573, 30226996, 31199472, 9361698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	26622051	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35711425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37759548	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31614121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	16775236, 17227768, 21757715, 23805253, 26355033, 28944847, 29097553, 29333450, 30623452, 31389668, 32382742, 32662257, 32851733, 33509040, 35406631, 37453421 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17986714	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22114711, 22403297, 23493574	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19720047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31468392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24958469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	17448565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	17448565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28320046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24931902, 31002200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26437953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26442469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24932809, 31422041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31124603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15907336, 28837922, 29382080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10806301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	10882310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27786596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28025042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31782099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	22381410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27453294, 28840618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23669880	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29504525, 37033267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28759152, 29385746, 30256492, 30742573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	29504525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22452979, 26640142, 35082341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22913968, 24402435, 28837922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27362697, 29504525		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	29504525	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	28177731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12414908, 1311795, 15297440, 15907336, 19554504, 22381410, 27786596, 28028797, 28257446, 29504525, 9732232		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19118529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	25596527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26438035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15292352, 1535055, 15731326, 17035674, 17317207, 18598108, 19219422, 19223519, 1999488, 20506294, 21604201, 23291341, 23326534, 2354749, 25299671 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	1999488, 22457223, 37174649	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27467133, 30813326, 32455814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	35363363	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	31588962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15059920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15907336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36012230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	17437443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	9293784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	9293784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30872638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30729535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30729535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	14688155, 15292352, 15731326, 18249389, 18322300, 20406953, 23493574, 23595973, 25064406, 28946816, 29693142, 30103849, 30623452, 31778716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	15292352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20011249, 23493574, 25064406	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30623452, 31874063, 32382742, 33228780, 35485360, 37047828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	24055495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24932809, 31422041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27121963, 31422041, 33619826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18635880	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17437443, 27453294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	26572137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25097857		★★★★★ ★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	31363171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	24410986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	24410986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	8314336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28061796, 30049187, 35920070, 37542344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28061796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26442469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31124603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25925563, 31124603, 33570246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subclinical hypothyroidism	Subclinical Hypothyroidism	BEFREE	30742573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29978611	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32425887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient hypothyroxinaemia of prematurity	Transient Hypothyroxinaemia Of Prematurity	BEFREE	29073628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	31074654	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	26932421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31430466		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC2A4 (solute carrier family 2 member 4)