SLC25A53 (solute carrier family 25 member 53)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401612
Gene name Solute carrier family 25 member 53
Gene symbol SLC25A53
Synonyms (NCBI Gene)
MCART6
Chromosome X
Chromosome location Xq22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
300941 31894 ENSG00000269743
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5H9E4
Protein name Solute carrier family 25 member 53 (Mitochondrial carrier triple repeat protein 6)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00153 Mito_carr 110 → 207 Mitochondrial carrier protein Family
PF00153 Mito_carr 23 → 108 Mitochondrial carrier protein Family
Sequence 
MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAM
AVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAA
GLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWP
VLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLVLYPLIVLVANMQ
SHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHS
RKELKTD
Sequence length 307
Interactions View interactions

No strongly related genes found yet for SLC25A53.

No additional diseases found yet through genes similar to SLC25A53.