Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	147407
Gene name	Solute carrier family 25 member 52
Gene symbol	SLC25A52
Synonyms (NCBI Gene)	MCART2
Chromosome	18
Chromosome location	18q12.1
Summary	This gene is similar to the mitochondrial carrier triple repeat 1 gene on chromosome 9. The gene is intronless and may be an evolving pseudogene; however, it is transcribed and it contains a full-length coding region so it is currently classified as a pro

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	32906142
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0051724	Function	NAD transmembrane transporter activity	IBA
GO:0051724	Function	NAD transmembrane transporter activity	IDA	32906142
GO:1990549	Process	Mitochondrial NAD transmembrane transport	IBA
GO:1990549	Process	Mitochondrial NAD transmembrane transport	IDA	32906142

MIM	HGNC	e!Ensembl
616153	23324	ENSG00000141437

Q3SY17

Protein name

Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52 (Mitochondrial NAD(+) transporter SLC25A52) (Mitochondrial carrier triple repeat protein 2) (Solute carrier family 25 member 52)

Protein function

Mitochondrial membrane carrier protein that mediates the import of NAD(+) into mitochondria (PubMed:32906142). Compared to SLC25A51, SLC25A52-mediated transport is not essential for the import of NAD(+) in mitochondria (PubMed:32906142). The tra

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	207 → 297	Mitochondrial carrier protein	Family
PF00153	Mito_carr	115 → 205	Mitochondrial carrier protein	Family
PF00153	Mito_carr	27 → 113	Mitochondrial carrier protein	Family

Sequence

MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQL
YGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFAT
HGVAAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL
FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRLQ
SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI

Sequence length

297

Interactions

View interactions

Related Genes Genes most often co-reported with SLC25A52 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SLC25A52.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SLC25A52 (see Related Genes above), that are NOT already directly curated for SLC25A52 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SLC25A52.

SLC25A52 (solute carrier family 25 member 52)

Save This Analysis