SLC25A41 (solute carrier family 25 member 41)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 284427
• Gene name: Solute carrier family 25 member 41
• Gene symbol: SLC25A41
• Synonyms (NCBI Gene): APC4, SCaMC-3L
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: SLC25A41 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016988	hsa-miR-335-5p	Microarray	18185580
MIRT1356909	hsa-miR-1289	CLIP-seq
MIRT1356910	hsa-miR-3130-3p	CLIP-seq
MIRT1356911	hsa-miR-3150a-3p	CLIP-seq
MIRT1356912	hsa-miR-3155	CLIP-seq
MIRT1356913	hsa-miR-3155b	CLIP-seq
MIRT1356914	hsa-miR-3175	CLIP-seq
MIRT1356915	hsa-miR-3620	CLIP-seq
MIRT1356916	hsa-miR-4292	CLIP-seq
MIRT1356917	hsa-miR-4419a	CLIP-seq
MIRT1356918	hsa-miR-4510	CLIP-seq
MIRT1356919	hsa-miR-4667-5p	CLIP-seq
MIRT1356920	hsa-miR-4700-5p	CLIP-seq
MIRT1356921	hsa-miR-4728-5p	CLIP-seq
MIRT1356922	hsa-miR-484	CLIP-seq
MIRT1356923	hsa-miR-939	CLIP-seq
MIRT2105706	hsa-miR-1913	CLIP-seq
MIRT2105707	hsa-miR-3140-3p	CLIP-seq
MIRT2105708	hsa-miR-324-3p	CLIP-seq
MIRT2330201	hsa-miR-1225-3p	CLIP-seq
MIRT2330202	hsa-miR-1912	CLIP-seq
MIRT2330203	hsa-miR-4256	CLIP-seq
MIRT2330204	hsa-miR-4323	CLIP-seq
MIRT2330205	hsa-miR-4758-3p	CLIP-seq
MIRT2394673	hsa-miR-3064-3p	CLIP-seq
MIRT2105707	hsa-miR-3140-3p	CLIP-seq
MIRT2394674	hsa-miR-4715-3p	CLIP-seq
MIRT2394675	hsa-miR-4776-3p	CLIP-seq
MIRT2624275	hsa-miR-1304	CLIP-seq
MIRT2624276	hsa-miR-4721	CLIP-seq
MIRT2624275	hsa-miR-1304	CLIP-seq
MIRT2624276	hsa-miR-4721	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005347	Function	ATP transmembrane transporter activity	IBA
GO:0005347	Function	ATP transmembrane transporter activity	IEA
GO:0005347	Function	ATP transmembrane transporter activity	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0015217	Function	ADP transmembrane transporter activity	IEA
GO:0015217	Function	ADP transmembrane transporter activity	ISS
GO:0015866	Process	ADP transport	IBA
GO:0015866	Process	ADP transport	IEA
GO:0015866	Process	ADP transport	ISS
GO:0015867	Process	ATP transport	IBA
GO:0015867	Process	ATP transport	IEA
GO:0015867	Process	ATP transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0140021	Process	Mitochondrial ADP transmembrane transport	IEA
GO:0140021	Process	Mitochondrial ADP transmembrane transport	ISS
GO:1990544	Process	Mitochondrial ATP transmembrane transport	IEA
GO:1990544	Process	Mitochondrial ATP transmembrane transport	ISS

Other IDs

• MIM: 610822
• HGNC: 28533
• e!Ensembl: ENSG00000181240

Protein

• UniProt ID: Q8N5S1
• Protein name: Mitochondrial carrier protein SCaMC-3L (Mitochondrial ATP-Mg/Pi carrier protein SLC25A41) (Small calcium-binding mitochondrial carrier protein 3-like) (SCaMC-3-like) (SCaMC-3L) (Solute carrier family 25 member 41)
• Protein function: Calcium-independent ATP-Mg/Pi exchanger that catalyzes the electroneutral exchange of Mg-ATP or free ADP against an hydrogenphosphate and participates in the net transport of adenine nucleotides across the mitochondria inner membrane. {ECO:00002
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	182 → 274	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	88 → 180	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	279 → 369	Mitochondrial carrier protein	Family

• Sequence:

  MGAQPGEPQNTCSRIQTLFRRVKTLLIKAPPPPQPPPPPPSWNPGCTHVYGYAFGHMHDN
  NLEHLPSQQVLDTGEQLMVPVEVLEVDNKEALWKFLLSGAMAGAVSRTGTAPLDRAKVYM
  QVYSSKTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGI
  QGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRA
  LYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMAS
  YPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVV
  YEAMKKTLGI

• Sequence length: 370

Related Genes

No strongly related genes found yet for SLC25A41.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC25A41.