SLC25A18 (solute carrier family 25 member 18)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 83733
• Gene name: Solute carrier family 25 member 18
• Gene symbol: SLC25A18
• Synonyms (NCBI Gene): GC2
• Chromosome: 22
• Chromosome location: 22q11.21

miRNA Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019171	hsa-miR-335-5p	Microarray	18185580
MIRT019472	hsa-miR-148b-3p	Microarray	17612493
MIRT1355570	hsa-miR-3136-5p	CLIP-seq
MIRT1355571	hsa-miR-3185	CLIP-seq
MIRT1355572	hsa-miR-4439	CLIP-seq
MIRT1355573	hsa-miR-4513	CLIP-seq
MIRT2329880	hsa-miR-605	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005280	Function	Amino acid:proton symporter activity	IDA	11897791
GO:0005280	Function	Amino acid:proton symporter activity	TAS
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0015183	Function	L-aspartate transmembrane transporter activity	IBA
GO:0015293	Function	Symporter activity	IEA
GO:0015810	Process	Aspartate transmembrane transport	IBA
GO:0015813	Process	L-glutamate transmembrane transport	IBA
GO:0015813	Process	L-glutamate transmembrane transport	IDA	11897791
GO:0016020	Component	Membrane	IEA
GO:0043490	Process	Malate-aspartate shuttle	IBA
GO:0043490	Process	Malate-aspartate shuttle	TAS
GO:0055085	Process	Transmembrane transport	IEA
GO:0070778	Process	L-aspartate transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

Other IDs

• MIM: 609303
• HGNC: 10988
• e!Ensembl: ENSG00000182902

Protein

• UniProt ID: Q9H1K4
• Protein name: Mitochondrial glutamate carrier 2 (GC-2) (Glutamate/H(+) symporter 2) (Solute carrier family 25 member 18)
• Protein function: Responsible for the transport of glutamate from the cytosol into the mitochondrial matrix with the concomitant import of a proton (symport system).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	4 → 97	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	217 → 305	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	99 → 214	Mitochondrial carrier protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, to a lesser extent in testis, and poorly in all the other tissues. {ECO:0000269|PubMed:11897791}.
• Sequence:

  MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEG
  FFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVT
  CPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLA
  GLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSGCVAGSIAAVAVT
  PLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAFMKGAGCRALVIAPLFGIAQG
  VYFIGIGERILKCFD

• Sequence length: 315

Pathways

Reactome Pathway:

Organic anion transporters

Related Genes

No strongly related genes found yet for SLC25A18.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC25A18.