SLC22A2 (solute carrier family 22 member 2)

Gene

• Entrez ID: 6582
• Gene name: Solute carrier family 22 member 2
• Gene symbol: SLC22A2
• Synonyms (NCBI Gene): Oct-02
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017635	hsa-miR-335-5p	Microarray	18185580
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT1354401	hsa-miR-4766-5p	CLIP-seq
MIRT1354402	hsa-miR-488	CLIP-seq
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT2104826	hsa-miR-3622a-3p	CLIP-seq
MIRT2104827	hsa-miR-3622b-3p	CLIP-seq
MIRT2104828	hsa-miR-412	CLIP-seq
MIRT2104829	hsa-miR-4282	CLIP-seq
MIRT2104830	hsa-miR-4659a-3p	CLIP-seq
MIRT2104831	hsa-miR-4659b-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT2104832	hsa-miR-513a-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
USF1	Activation	17314196
USF1	Unknown	18508876

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005275	Function	Amine transmembrane transporter activity	IDA	9687576
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IDA	15817714
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	9687576, 16581093
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	TAS
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9260930
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006836	Process	Neurotransmitter transport	IDA	9687576
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0006837	Process	Serotonin transport	IDA	9687576, 16581093
GO:0007589	Process	Body fluid secretion	TAS	9260930
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	9687576, 12089365, 15212162, 16581093, 17072098, 17460754
GO:0008504	Function	Monoamine transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	EXP	19141712
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	9260930, 9687576, 12089365, 12538837, 16024787, 17460754, 21128598, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	IMP	23864433
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9260930
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015179	Function	L-amino acid transmembrane transporter activity	IMP	23864433
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IEA
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015220	Function	Choline transmembrane transporter activity	IDA	9687576
GO:0015234	Function	Thiamine transmembrane transporter activity	IDA	24961373
GO:0015489	Function	Putrescine transmembrane transporter activity	IDA	21128598
GO:0015489	Function	Putrescine transmembrane transporter activity	IEA
GO:0015562	Function	Efflux transmembrane transporter activity	IDA	9687576
GO:0015606	Function	Spermidine transmembrane transporter activity	ISS
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	9260930
GO:0015695	Process	Organic cation transport	IBA
GO:0015695	Process	Organic cation transport	IDA	16024787
GO:0015695	Process	Organic cation transport	IDA	9687576, 22806583, 24291757
GO:0015695	Process	Organic cation transport	IMP	23864433
GO:0015695	Process	Organic cation transport	TAS	9260930
GO:0015697	Process	Quaternary ammonium group transport	IEA
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015837	Process	Amine transport	IDA	9687576
GO:0015847	Process	Putrescine transport	IDA	21128598
GO:0015848	Process	Spermidine transport	ISS
GO:0015870	Process	Acetylcholine transport	IDA	15817714
GO:0015871	Process	Choline transport	IDA	9687576
GO:0015872	Process	Dopamine transport	IDA	16581093
GO:0015872	Process	Dopamine transport	ISS
GO:0015874	Process	Norepinephrine transport	IDA	9687576, 16581093
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9260930
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IDA	15817714, 20477935
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	9687576, 22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0019534	Function	Toxin transmembrane transporter activity	ISS	30120945
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042908	Process	Xenobiotic transport	IDA	9687576, 22806583, 24291757
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042908	Process	Xenobiotic transport	IMP	20477935
GO:0042908	Process	Xenobiotic transport	ISS	30120945
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	12395288, 16394027
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935
GO:0048241	Process	Epinephrine transport	IDA	16581093
GO:0048241	Process	Epinephrine transport	ISS
GO:0051608	Process	Histamine transport	IDA	16581093
GO:0051610	Process	Serotonin uptake	IDA	9687576
GO:0051610	Process	Serotonin uptake	IEA
GO:0051615	Process	Histamine uptake	IDA	9687576
GO:0051620	Process	Norepinephrine uptake	IDA	9687576
GO:0051620	Process	Norepinephrine uptake	TAS
GO:0055085	Process	Transmembrane transport	IEA
GO:0061459	Function	L-arginine transmembrane transporter activity	IMP	23864433
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071934	Process	Thiamine transmembrane transport	IDA	24961373
GO:0071934	Process	Thiamine transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	TAS
GO:0089718	Process	Amino acid import across plasma membrane	IMP	23864433
GO:0090494	Process	Dopamine uptake	IDA	9687576
GO:0090494	Process	Dopamine uptake	IEA
GO:0097638	Process	L-arginine import across plasma membrane	IMP	23864433
GO:0098793	Component	Presynapse	IEA
GO:0140115	Process	Export across plasma membrane	IDA	9687576
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IMP	23864433
GO:1903711	Process	Spermidine transmembrane transport	IEA
GO:1903826	Process	L-arginine transmembrane transport	IEA
GO:1990748	Process	Cellular detoxification	IDA	9687576, 22806583, 24291757
GO:1990748	Process	Cellular detoxification	IEA
GO:1990748	Process	Cellular detoxification	IMP	20477935
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

Other IDs

• MIM: 602608
• HGNC: 10966
• e!Ensembl: ENSG00000112499

Protein

• UniProt ID: O15244
• Protein name: Solute carrier family 22 member 2 (Organic cation transporter 2) (hOCT2)
• Protein function: Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:9260930, PubMed:9687576). Functions as a Na(+)-independent, bidire
• PDB: 8ET9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	91 → 529	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in kidney, in the cortex and medulla (PubMed:11912245, PubMed:12089365, PubMed:9260930). Localized in testis, mostly to peritubular myoid cells and Leydig cells and also detected along the basal membrane of Sertoli cel
• Sequence:

  MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
  LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
  PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
  LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
  YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
  RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
  LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
  SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
  TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
  KMIYLQVQKLDIPLN

• Sequence length: 555

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	12459631		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15796964		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30561642		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	30561642	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30561642		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31644961		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21346370		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	21346370		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12507907, 15202521, 20331331, 28851661		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10905058		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36076515	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20067471		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37658577	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29241711		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	30119251		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30168369		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20383146, 28483424		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	20383146, 21931561, 22479191		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10905058		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20551056		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20551056, 28992563	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27440728, 31088315, 31649850		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29551575		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	31451708		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20139901	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15531531, 20429798		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20139901, 22882994, 25573751, 25662675, 27609360, 31012983		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20429798		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12459631, 14694522, 28143608		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17060063		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	17060063	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	30561642	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	25823781	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	27590272	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11154228, 11280769, 15796964, 8639794		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17060063	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17060063		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20429798		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	30951542		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	19224997		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	22525860		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	28414026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	20383146, 31152163		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16891199, 17074681, 20141429, 23955454		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28955207		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31156624	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31156624		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16186795		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	11850478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24102360		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20067471		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22223530, 27440728, 28154203, 29445029		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	28851661		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30465787		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21438833, 7600290		★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	21867533		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22346751		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12072546, 12598320, 19504395, 21706474, 27435027		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	24525501, 28851661		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	27401566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	29445029		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20067471		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	8639794		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10905058		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10905058		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27440728, 31088315, 31649850		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29160778		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31644961		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28992563		★☆☆☆☆ Found in Text Mining only
Spermatocytic seminoma	Spermatocytic Seminoma	BEFREE	21706474		★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	20108380		★☆☆☆☆ Found in Text Mining only