SLC22A13 (solute carrier family 22 member 13)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9390
• Gene name: Solute carrier family 22 member 13
• Gene symbol: SLC22A13
• Synonyms (NCBI Gene): OAT10, OCTL1, OCTL3, ORCTL-3, ORCTL3
• Chromosome: 3
• Chromosome location: 3p22.2
• Summary: This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small mo

miRNA Show/Hide all (54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029224	hsa-miR-26b-5p	Microarray	19088304
MIRT1354316	hsa-miR-1208	CLIP-seq
MIRT1354317	hsa-miR-1256	CLIP-seq
MIRT1354318	hsa-miR-1908	CLIP-seq
MIRT1354319	hsa-miR-192	CLIP-seq
MIRT1354320	hsa-miR-215	CLIP-seq
MIRT1354321	hsa-miR-3130-5p	CLIP-seq
MIRT1354322	hsa-miR-3133	CLIP-seq
MIRT1354323	hsa-miR-3141	CLIP-seq
MIRT1354324	hsa-miR-3147	CLIP-seq
MIRT1354325	hsa-miR-3675-5p	CLIP-seq
MIRT1354326	hsa-miR-4280	CLIP-seq
MIRT1354327	hsa-miR-4482	CLIP-seq
MIRT1354328	hsa-miR-4511	CLIP-seq
MIRT1354329	hsa-miR-4529-5p	CLIP-seq
MIRT1354330	hsa-miR-4539	CLIP-seq
MIRT1354331	hsa-miR-4640-5p	CLIP-seq
MIRT1354332	hsa-miR-4652-3p	CLIP-seq
MIRT1354333	hsa-miR-4662a-5p	CLIP-seq
MIRT1354334	hsa-miR-4676-5p	CLIP-seq
MIRT1354335	hsa-miR-4720-5p	CLIP-seq
MIRT1354336	hsa-miR-4726-5p	CLIP-seq
MIRT1354337	hsa-miR-4772-3p	CLIP-seq
MIRT1354338	hsa-miR-4787-5p	CLIP-seq
MIRT1354339	hsa-miR-4799-3p	CLIP-seq
MIRT1354340	hsa-miR-499-3p	CLIP-seq
MIRT1354341	hsa-miR-499a-3p	CLIP-seq
MIRT1354342	hsa-miR-575	CLIP-seq
MIRT1354343	hsa-miR-581	CLIP-seq
MIRT1354344	hsa-miR-663	CLIP-seq
MIRT1354345	hsa-miR-767-5p	CLIP-seq
MIRT1354346	hsa-miR-892a	CLIP-seq
MIRT2104822	hsa-miR-4310	CLIP-seq
MIRT1354324	hsa-miR-3147	CLIP-seq
MIRT2329447	hsa-miR-3192	CLIP-seq
MIRT2329448	hsa-miR-323-5p	CLIP-seq
MIRT2329449	hsa-miR-3616-5p	CLIP-seq
MIRT2329450	hsa-miR-3647-5p	CLIP-seq
MIRT2329451	hsa-miR-4314	CLIP-seq
MIRT1354329	hsa-miR-4529-5p	CLIP-seq
MIRT1354331	hsa-miR-4640-5p	CLIP-seq
MIRT2329452	hsa-miR-4646-5p	CLIP-seq
MIRT1354336	hsa-miR-4726-5p	CLIP-seq
MIRT2329453	hsa-miR-4795-5p	CLIP-seq
MIRT2329454	hsa-miR-573	CLIP-seq
MIRT2329455	hsa-miR-622	CLIP-seq
MIRT2329456	hsa-miR-876-3p	CLIP-seq
MIRT2394639	hsa-miR-1207-5p	CLIP-seq
MIRT2394640	hsa-miR-1909	CLIP-seq
MIRT2394641	hsa-miR-3616-3p	CLIP-seq
MIRT2394642	hsa-miR-4436b-3p	CLIP-seq
MIRT2394643	hsa-miR-4652-5p	CLIP-seq
MIRT2394644	hsa-miR-4763-3p	CLIP-seq
MIRT2394645	hsa-miR-508-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002854	Process	Positive regulation of T cell mediated cytotoxicity directed against tumor cell target	IDA	19282870
GO:0005783	Component	Endoplasmic reticulum	IDA	19282870
GO:0005794	Component	Golgi apparatus	IDA	19282870
GO:0005886	Component	Plasma membrane	IDA	19282870
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0015143	Function	Urate transmembrane transporter activity	IDA	18411268, 35144162
GO:0015747	Process	Urate transport	IDA	18411268, 35144162
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	18411268
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0034355	Process	NAD+ biosynthetic process via the salvage pathway	TAS
GO:0045922	Process	Negative regulation of fatty acid metabolic process	IDA	24769897
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0090416	Function	Nicotinate transmembrane transporter activity	EXP	18411268
GO:0090416	Function	Nicotinate transmembrane transporter activity	IDA	18411268, 35144162
GO:2001142	Process	Nicotinate transport	IDA	18411268, 35144162

Other IDs

• MIM: 604047
• HGNC: 8494
• e!Ensembl: ENSG00000172940

Protein

• UniProt ID: Q9Y226
• Protein name: Solute carrier family 22 member 13 (Organic anion transporter 10) (OAT10) (Organic cation transporter-like 3) (ORCTL-3) (ORCTL3)
• Protein function: Anion antiporter that mediates the transport of urate, orotate and nicotinate in exchange for organic or inorganic anions (PubMed:18411268, PubMed:31780526, PubMed:35144162, PubMed:35462902). Translocates urate and orotate across the apical memb
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	118 → 513	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous (PubMed:10072596). Highly expressed in kidneys and to a weaker extent in brain, heart, and intestine (PubMed:18411268). In kidneys, expressed in proximal convoluted tubule (PubMed:18411268, PubMed:31780526, PubMed:35462902).
• Sequence:

  MAQFVQVLAEIGDFGRFQIQLLILLCVLNFLSPFYFFAHVFMVLDEPHHCAVAWVKNHTF
  NLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRL
  PSLKNEFNLVCDRKHLKDTTQSVFMAGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGL
  ATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVL
  AGLAYGFRNWRLLQITGTAPGLLLFFYFWALPESARWLLTRGRMDEAIQLIQKAASVNRR
  KLSPELMNQLVPEKTGPSGNALDLFRHPQLRKVTLIIFCVWFVDSLGYYGLSLQVGDFGL
  DVYLTQLIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIFIPADLPVVVTM
  LAVVGKMATAAAFTISYVYSAELFPTILRQTGMGLVGIFSRIGGILTPLVILLGEYHAAL
  PMLIYGSLPIVAGLLCTLLPETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSS
  PGVAFVSSTYF

• Sequence length: 551

Pathways

Reactome Pathway:

Nicotinamide salvaging

Related Genes

No strongly related genes found yet for SLC22A13.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC22A13.