SLC22A1 (solute carrier family 22 member 1)

Gene

• Entrez ID: 6580
• Gene name: Solute carrier family 22 member 1
• Gene symbol: SLC22A1
• Synonyms (NCBI Gene): HOCT1, OCT1, oct1_cds
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT646165	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT646164	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT646163	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT646162	hsa-miR-4275	HITS-CLIP	23824327
MIRT646161	hsa-miR-3941	HITS-CLIP	23824327
MIRT646160	hsa-miR-4672	HITS-CLIP	23824327
MIRT646159	hsa-miR-466	HITS-CLIP	23824327
MIRT646165	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT646164	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT646163	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT646162	hsa-miR-4275	HITS-CLIP	23824327
MIRT646161	hsa-miR-3941	HITS-CLIP	23824327
MIRT646160	hsa-miR-4672	HITS-CLIP	23824327
MIRT646159	hsa-miR-466	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IDA	15817714
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	12439218, 24688079, 24961373, 35469921
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IEA
GO:0005330	Function	Dopamine:sodium symporter activity	IEA
GO:0005334	Function	Norepinephrine:sodium symporter activity	IEA
GO:0005515	Function	Protein binding	IPI	11543633, 21988832, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9187257
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006836	Process	Neurotransmitter transport	IDA	24688079
GO:0006837	Process	Serotonin transport	IDA	12439218, 24961373, 35469921
GO:0006837	Process	Serotonin transport	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	9260930, 12439218, 24688079, 24961373, 35469921
GO:0008504	Function	Monoamine transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	EXP	19141712
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	9260930, 17460754, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9187257
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IEA
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IEA
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015234	Function	Thiamine transmembrane transporter activity	IEA
GO:0015489	Function	Putrescine transmembrane transporter activity	IDA	21128598
GO:0015489	Function	Putrescine transmembrane transporter activity	IEA
GO:0015606	Function	Spermidine transmembrane transporter activity	IEA
GO:0015606	Function	Spermidine transmembrane transporter activity	ISS
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	23567998
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IEA
GO:0015695	Process	Organic cation transport	IBA
GO:0015695	Process	Organic cation transport	IDA	22806583, 24291757
GO:0015695	Process	Organic cation transport	IEA
GO:0015695	Process	Organic cation transport	TAS	9187257
GO:0015697	Process	Quaternary ammonium group transport	IDA	23567998
GO:0015697	Process	Quaternary ammonium group transport	IEA
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0015844	Process	Monoamine transport	IDA	35469921
GO:0015844	Process	Monoamine transport	IEA
GO:0015847	Process	Putrescine transport	IDA	21128598
GO:0015848	Process	Spermidine transport	IEA
GO:0015848	Process	Spermidine transport	ISS
GO:0015870	Process	Acetylcholine transport	IDA	15817714
GO:0015870	Process	Acetylcholine transport	IEA
GO:0015872	Process	Dopamine transport	IDA	35469921
GO:0015872	Process	Dopamine transport	IEA
GO:0015874	Process	Norepinephrine transport	IDA	24688079
GO:0015874	Process	Norepinephrine transport	IEA
GO:0015888	Process	Thiamine transport	IDA	24961373, 35469921
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9187257
GO:0016323	Component	Basolateral plasma membrane	IDA	12719534
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	TAS
GO:0016324	Component	Apical plasma membrane	IDA	15817714, 19536068, 20477935, 23680637, 28362799
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IDA	16263091
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042908	Process	Xenobiotic transport	IDA	9260930, 11408531, 15389554, 22806583, 24291757, 35469921
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042908	Process	Xenobiotic transport	IMP	20477935, 28362799
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	9260930, 11408531, 15389554, 35469921
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935, 28362799
GO:0048241	Process	Epinephrine transport	IDA	35469921
GO:0048241	Process	Epinephrine transport	IEA
GO:0051610	Process	Serotonin uptake	IDA	24688079
GO:0051610	Process	Serotonin uptake	IEA
GO:0051620	Process	Norepinephrine uptake	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071934	Process	Thiamine transmembrane transport	IDA	24961373, 35469921
GO:0071934	Process	Thiamine transmembrane transport	IEA
GO:0072237	Process	Metanephric proximal tubule development	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	TAS
GO:0090494	Process	Dopamine uptake	IDA	24688079
GO:0090494	Process	Dopamine uptake	IEA
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901235	Function	(R)-carnitine transmembrane transporter activity	IEA
GO:1902270	Process	(R)-carnitine transmembrane transport	IEA
GO:1902616	Process	O-acyl-L-carnitine transmembrane transport	IEA
GO:1903711	Process	Spermidine transmembrane transport	IEA
GO:1990748	Process	Cellular detoxification	IDA	22806583, 24291757
GO:1990748	Process	Cellular detoxification	IEA
GO:1990748	Process	Cellular detoxification	IMP	20477935
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

Other IDs

• MIM: 602607
• HGNC: 10963
• e!Ensembl: ENSG00000175003

Protein

• UniProt ID: O15245
• Protein name: Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
• Protein function: Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:11388889, PubMed:11408531, PubMed:12439218, PubMed:12719534, PubMe
• PDB: 8ET6, 8ET7, 8ET8, 8JTS, 8JTT, 8JTV, 8JTW, 8JTX, 8JTY, 8JTZ, 8JU0, 8SC1, 8SC2, 8SC3, 8SC4, 8SC6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	89 → 371	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with high level in liver (PubMed:11388889, PubMed:23680637, PubMed:9187257, PubMed:9260930). In liver, expressed around the central vein (PubMed:16263091). Expressed in kidney (PubMed:9187257, PubMed:9260930). Expresse
• Sequence:

  MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
  RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
  CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
  GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
  QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
  IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
  YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
  IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
  PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
  TIYLKVQTSEPSGT

• Sequence length: 554

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Aganglionic megacolon	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	19327156		★☆☆☆☆ Found in Text Mining only
Adult onset autosomal dominant leukodystrophy	Leukodystrophy	BEFREE	23261988		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16173915		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15751072	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	22179738		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16173915		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31266507		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	8121549		★☆☆☆☆ Found in Text Mining only
Birdshot chorioretinopathy	Birdshot Chorioretinopathy	BEFREE	28456419		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	22521288		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17700520		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18550719	Stimulate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	27407111	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	40026294	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16278805		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22439694, 26872727, 28178663, 30628708, 31953214, 36881382, 37722628	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21986525		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	9422986		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23440379, 23532667, 30972782		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	19591196, 22498645		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28754554, 31292298		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASCAT_DG	29545352		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31059499		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	35167937	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23440379		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	22319020		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15751072, 21706137		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27799064	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17476355		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17476355, 19381165, 26464716		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24145224, 26464716, 28947922, 35167937	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19336679, 20639304, 24145224, 26464716, 26605869, 30041690, 35893047, 36734726, 40004467	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19336679, 20639304, 22735389, 22882994, 24740684, 25492374, 25510240, 26464716, 26605869, 26802434, 29659562, 29979413, 30885951, 31012983		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28817838	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	32710539	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	22684023		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	19325871	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	24145224		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27610747, 31404235		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21986525		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	26877236		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23053895		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23053895		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35365176	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31630405		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22166890		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	26605869	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	22179738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	16648862	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	7753827	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	25025077	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29480578		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12019209		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24145224	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	29545352		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18483382, 28025785, 31295506		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28025785	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28025785	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28025785, 31295506		★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	23261988	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28817838		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21985966, 22439694, 23532667, 26872727, 28178663, 30592786, 31350763, 31413596		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27543206	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17700520		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23053895		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31350763		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27270436		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31463827		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10544969, 26877236, 30592786, 31059499, 31350763, 31463827		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31059499		★☆☆☆☆ Found in Text Mining only
Mandibuloacral dysplasia with type A lipodystrophy	Mandibuloacral dysplasia	Pubtator	25324471	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	18390905	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28942964		★☆☆☆☆ Found in Text Mining only
Miosis disorder	Miosis Disorder	BEFREE	21562485		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17568400, 18559609, 18669873, 20147974, 22207690, 22508387, 23272163, 24117365, 24215657, 24352644, 24469953, 24524306, 25039279, 26300393, 27770655, 28286932, 29427770		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28408323	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	26464716		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12598320, 16827100, 18550719, 21986525, 22439694, 23440379, 23532667, 23934321, 27270436, 28178663, 29330289, 30042821, 30592786, 31059499		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28817838		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16360016		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20814161, 27407018		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20956498		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20956498	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	27407018	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	29949790	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	31295506		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	20680652	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28965931, 31701892		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20660041		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30959948	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23612856, 24620780		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27270436		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17679089, 19058140	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27819678		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30181619		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15751072, 28455521, 9797555		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30012335		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10544969		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31463827		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31391037	Associate	★☆☆☆☆ Found in Text Mining only
Thiamine Deficiency	Thiamine Deficiency	BEFREE	29659562		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22524831	Associate	★☆☆☆☆ Found in Text Mining only