SLC13A2 (solute carrier family 13 member 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9058
• Gene name: Solute carrier family 13 member 2
• Gene symbol: SLC13A2
• Synonyms (NCBI Gene): NADC1, NaCT, NaDC-1, SDCT1
• Chromosome: 17
• Chromosome location: 17q11.2
• Summary: The protein encoded by this gene is a sodium-coupled citrate transporter that is regulated by the chaperone activity of cyclophilin b. The encoded protein may play a role in the formation of kidney stones. [provided by RefSeq, Oct 2016]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022335	hsa-miR-124-3p	Microarray	18668037

Gene ontology (GO) Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8967342
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0015138	Function	Fumarate transmembrane transporter activity	IBA
GO:0015138	Function	Fumarate transmembrane transporter activity	IDA	10894787
GO:0015138	Function	Fumarate transmembrane transporter activity	IEA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IBA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IDA	10894787
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IEA
GO:0015141	Function	Succinate transmembrane transporter activity	IBA
GO:0015141	Function	Succinate transmembrane transporter activity	IDA	10894787, 26176240
GO:0015141	Function	Succinate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015361	Function	Low-affinity sodium:dicarboxylate symporter activity	TAS	8967342
GO:0015370	Function	Solute:sodium symporter activity	IEA
GO:0015741	Process	Fumarate transport	IBA
GO:0015741	Process	Fumarate transport	IDA	10894787
GO:0015741	Process	Fumarate transport	IEA
GO:0015742	Process	Alpha-ketoglutarate transport	IBA
GO:0015742	Process	Alpha-ketoglutarate transport	IDA	10894787
GO:0015742	Process	Alpha-ketoglutarate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8967342
GO:0016324	Component	Apical plasma membrane	IDA	27927654
GO:0016324	Component	Apical plasma membrane	IEA
GO:0017153	Function	Sodium:dicarboxylate symporter activity	IBA
GO:0017153	Function	Sodium:dicarboxylate symporter activity	IDA	10894787
GO:0017153	Function	Sodium:dicarboxylate symporter activity	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071285	Process	Cellular response to lithium ion	IBA
GO:0071285	Process	Cellular response to lithium ion	IDA	10894787
GO:0071285	Process	Cellular response to lithium ion	IEA
GO:0071422	Process	Succinate transmembrane transport	IBA
GO:0071422	Process	Succinate transmembrane transport	IDA	10894787, 26176240
GO:0071422	Process	Succinate transmembrane transport	IEA

Other IDs

• MIM: 604148
• HGNC: 10917
• e!Ensembl: ENSG00000007216

Protein

• UniProt ID: Q13183
• Protein name: Solute carrier family 13 member 2 (Na(+)/dicarboxylate cotransporter 1) (NaDC-1) (Renal sodium/dicarboxylate cotransporter)
• Protein function: Low-affinity sodium-dicarboxylate cotransporter, that mediates the entry of citric acid cycle intermediates, such as succinate, citrate, fumarate and alpha-ketoglutarate (2-oxoglutarate) into the small intestine and renal proximal tubule (PubMed
• PDB: 8W6C , 8W6D , 8W6G
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00939	Na_sulph_symp	6 → 565	Sodium:sulfate symporter transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in kidney and intestine (PubMed:8967342). In kidney expressed in the proximal tubule (at protein level) (PubMed:27927654). {ECO:0000269|PubMed:27927654, ECO:0000269|PubMed:8967342}.
• Sequence:

  MATCWQALWAYRSYLIVFFVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTA
  LFPLILFPMMGIVDASEVAVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVR
  PAPLILGFMLVTAFLSMWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQ
  EPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGT
  APNLVLQGQINSLFPQNGNVVNFASWFSFAFPTMVILLLLAWLWLQILFLGFNFRKNFGI
  GEKMQEQQQAAYCVIQTEHRLLGPMTFAEKAISILFVILVLLWFTREPGFFLGWGNLAFP
  NAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWN
  IVLLLGGGYALAKGSERSGLSEWLGNKLTPLQSVPAPAIAIILSLLVATFTECTSNVATT
  TIFLPILASMAQAICLHPLYVMLPCTLATSLAFMLPVATPPNAIVFSFGDLKVLDMARAG
  FLLNIIGVLIIALAINSWGIPLFSLHSFPSWAQSNTTAQCLPSLANTTTPSP

• Sequence length: 592

Pathways

Reactome Pathway:

Sodium-coupled sulphate, di- and tri-carboxylate transporters

Related Genes

No strongly related genes found yet for SLC13A2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLC13A2.