SLC10A5 (solute carrier family 10 member 5)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 347051
Gene name Solute carrier family 10 member 5
Gene symbol SLC10A5
Synonyms (NCBI Gene)
P5
Chromosome 8
Chromosome location 8q21.13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0006811 Process Monoatomic ion transport IEA
GO:0006814 Process Sodium ion transport IEA
GO:0008508 Function Bile acid:sodium symporter activity IBA
GO:0015293 Function Symporter activity IEA
GO:0015721 Process Bile acid and bile salt transport IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618582 22981 ENSG00000253598
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5PT55
Protein name Sodium/bile acid cotransporter 5 (Na(+)/bile acid cotransporter 5) (Solute carrier family 10 member 5)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01758 SBF 148 → 332 Sodium Bile acid symporter family Family
Sequence 
MIRKLFIVLLLLLVTIEEARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHL
FVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKN
VKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIELQLFQTVWKRPLPVILG
AVTQFFLMPFCGFLLSQIVALPEAQAFGVVMTCTCPGGGGGYLFALLLDGDFTLAILMTC
TSTLLALIMMPVNSYIYSRILGLSGTFHIPVSKIVSTLLFILVPVSIGIVIKHRIPEKAS
FLERIIRPLSFILMFVGIYLTFTVGLVFLKTDNLEVILLGLLVPALGLLFGYSFAKVCTL
PLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAPFTVAMCSGCEMLLIILVYKA
KKRCIFFLQDKRKRNFLI
Sequence length 438
Interactions View interactions

No strongly related genes found yet for SLC10A5.

No additional diseases found yet through genes similar to SLC10A5.