SLAIN1 (SLAIN motif family member 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 122060
• Gene name: SLAIN motif family member 1
• Gene symbol: SLAIN1
• Synonyms (NCBI Gene): C13orf32
• Chromosome: 13
• Chromosome location: 13q22.3

miRNA Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006202	hsa-miR-302a-3p	Luciferase reporter assay	22012620
MIRT006202	hsa-miR-302a-3p	Luciferase reporter assay	22012620
MIRT006202	hsa-miR-302a-3p	Luciferase reporter assay	22012620
MIRT006202	hsa-miR-302a-3p	Luciferase reporter assay	22012620
MIRT006202	hsa-miR-302a-3p	Luciferase reporter assay	22012620
MIRT006202	hsa-miR-302a-3p	Luciferase reporter assay	22012620
MIRT020144	hsa-miR-130b-3p	Sequencing	20371350
MIRT027889	hsa-miR-96-5p	Sequencing	20371350
MIRT031113	hsa-miR-19b-3p	Sequencing	20371350
MIRT049036	hsa-miR-92a-3p	CLASH	23622248
MIRT069118	hsa-miR-130a-3p	Luciferase reporter assay, Microarray, qRT-PCR	26074357
MIRT069118	hsa-miR-130a-3p	Luciferase reporter assay, Microarray, qRT-PCR	26074357
MIRT2104146	hsa-miR-1179	CLIP-seq
MIRT2104147	hsa-miR-664	CLIP-seq
MIRT2394567	hsa-miR-1266	CLIP-seq
MIRT2394568	hsa-miR-130a	CLIP-seq
MIRT2394569	hsa-miR-130b	CLIP-seq
MIRT2394570	hsa-miR-301a	CLIP-seq
MIRT2394571	hsa-miR-301b	CLIP-seq
MIRT2394572	hsa-miR-302a	CLIP-seq
MIRT2394573	hsa-miR-302b	CLIP-seq
MIRT2394574	hsa-miR-302c	CLIP-seq
MIRT2394575	hsa-miR-302d	CLIP-seq
MIRT2394576	hsa-miR-302e	CLIP-seq
MIRT2394577	hsa-miR-3664-3p	CLIP-seq
MIRT2394578	hsa-miR-3666	CLIP-seq
MIRT2394579	hsa-miR-372	CLIP-seq
MIRT2394580	hsa-miR-373	CLIP-seq
MIRT2394581	hsa-miR-4269	CLIP-seq
MIRT2394582	hsa-miR-4295	CLIP-seq
MIRT2394583	hsa-miR-4514	CLIP-seq
MIRT2394584	hsa-miR-4518	CLIP-seq
MIRT2394585	hsa-miR-454	CLIP-seq
MIRT2394586	hsa-miR-4692	CLIP-seq
MIRT2394587	hsa-miR-4742-5p	CLIP-seq
MIRT2394588	hsa-miR-519a	CLIP-seq
MIRT2394589	hsa-miR-519b-3p	CLIP-seq
MIRT2394590	hsa-miR-519c-3p	CLIP-seq
MIRT2394591	hsa-miR-520a-3p	CLIP-seq
MIRT2394592	hsa-miR-520b	CLIP-seq
MIRT2394593	hsa-miR-520c-3p	CLIP-seq
MIRT2394594	hsa-miR-520d-3p	CLIP-seq
MIRT2394595	hsa-miR-520e	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007020	Process	Microtubule nucleation	IBA
GO:0031116	Process	Positive regulation of microtubule polymerization	IBA
GO:0031122	Process	Cytoplasmic microtubule organization	IBA
GO:0035371	Component	Microtubule plus-end	IBA

Other IDs

• MIM: 610491
• HGNC: 26387
• e!Ensembl: ENSG00000139737

Protein

• UniProt ID: Q8ND83
• Protein name: SLAIN motif-containing protein 1
• Protein function: Microtubule plus-end tracking protein that might be involved in the regulation of cytoplasmic microtubule dynamics, microtubule organization and microtubule elongation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15301	SLAIN	232 → 568	SLAIN motif-containing family	Family
  PF15301	SLAIN	187 → 239	SLAIN motif-containing family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in embryonic stem cells (PubMed:16546155). Expressed in brain (PubMed:21646404). {ECO:0000269|PubMed:16546155, ECO:0000269|PubMed:21646404}.
• Sequence:

  MMAEQVKCASAGVSSGAGSGPVVNAELEVKKLQELVRKLEKQNEQLRSRAASAAAAPHLL
  LLPPPPPAAPPPAGLQPLGPRSPPAATATAAASGGLGPAFPGTFCLPSPAPSLLCSLAQP
  PEAPFVYFKPAAGFFGAGGGGPEPGGAGTPPGAAAAPPSPPPTLLDEVELLDLESVAAWR
  DEDDYTWLYIGSSKTFTSSEKSLTPLQWCRHVLDNPTPEMEAARRSLCFRLEQGYTSRGS
  PLSPQSSIDSELSTSELEDDSISMGYKLQDLTDVQIMARLQEESLRQDYASTSASVSRHS
  SSVSLSSGKKGTCSDQEYDQYSLEDEEEFDHLPPPQPRLPRCSPFQRGIPHSQTFSSIRE
  CRRSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSTTAISSNI
  SSPVTVRNSQSFDSSLHGAGNGISRIQSCIPSPGQLQHRVHSVGHFPVSIRQPLKATAYV
  SPTVQGSSNMPLSNGLQLYSNTGIPTPNKAAASGIMGRSALPRPSLAINGSNLPRSKIAQ
  PVRSFLQPPKPLSSLSTLRDGNWRDGCY

• Sequence length: 568

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
SLAIN1-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37783761	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30302825		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for SLAIN1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SLAIN1.