SIVA1 (SIVA1 apoptosis inducing factor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10572
• Gene name: SIVA1 apoptosis inducing factor
• Gene symbol: SIVA1
• Synonyms (NCBI Gene): CD27BP, SIVA, Siva-1, Siva-2
• Chromosome: 14
• Chromosome location: 14q32.33
• Summary: This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) super

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019564	hsa-miR-340-5p	Sequencing	20371350
MIRT019564	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT561608	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT561607	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT069423	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT069422	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT561606	hsa-miR-4311	PAR-CLIP	20371350
MIRT561605	hsa-miR-1276	PAR-CLIP	20371350
MIRT069429	hsa-miR-583	PAR-CLIP	20371350
MIRT069432	hsa-miR-664a-3p	PAR-CLIP	20371350
MIRT561604	hsa-miR-877-3p	PAR-CLIP	20371350
MIRT561603	hsa-miR-581	PAR-CLIP	20371350
MIRT561602	hsa-miR-3909	PAR-CLIP	20371350
MIRT561601	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT069431	hsa-miR-1298-5p	PAR-CLIP	20371350
MIRT561600	hsa-miR-6881-3p	PAR-CLIP	20371350
MIRT069422	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT069423	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT069422	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26367773
MIRT019564	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT561608	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT561607	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT069423	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT069422	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT561606	hsa-miR-4311	PAR-CLIP	20371350
MIRT561605	hsa-miR-1276	PAR-CLIP	20371350
MIRT069429	hsa-miR-583	PAR-CLIP	20371350
MIRT069432	hsa-miR-664a-3p	PAR-CLIP	20371350
MIRT561604	hsa-miR-877-3p	PAR-CLIP	20371350
MIRT561603	hsa-miR-581	PAR-CLIP	20371350
MIRT561602	hsa-miR-3909	PAR-CLIP	20371350
MIRT561601	hsa-miR-6852-3p	PAR-CLIP	20371350
MIRT069431	hsa-miR-1298-5p	PAR-CLIP	20371350
MIRT561600	hsa-miR-6881-3p	PAR-CLIP	20371350

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	15105421
E2F1	Activation	15105421
TP53	Activation	15105421
TP53	Activation	15105421

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001618	Function	Virus receptor activity	ISS
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005175	Function	CD27 receptor binding	IBA
GO:0005175	Function	CD27 receptor binding	IEA
GO:0005175	Function	CD27 receptor binding	IPI	9177220, 16683188
GO:0005515	Function	Protein binding	IPI	9177220, 12011449, 14739602, 16683188, 17348035, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	15034012
GO:0005737	Component	Cytoplasm	IDA	12011449, 14739602
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	12011449
GO:0006915	Process	Apoptotic process	IEA
GO:0006924	Process	Activation-induced cell death of T cells	IDA	16491128
GO:0008270	Function	Zinc ion binding	IDA	16683188
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	16491128
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	IMP	16491128
GO:0070231	Process	T cell apoptotic process	IMP	16491128
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	9177220
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	12011449
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	12011449
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	15034012

Other IDs

• MIM: 605567
• HGNC: 17712
• e!Ensembl: ENSG00000184990

Protein

• UniProt ID: O15304
• Protein name: Apoptosis regulatory protein Siva (CD27-binding protein) (CD27BP)
• Protein function: Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis. {ECO:0000269|PubMed:12011449, ECO:0000269|PubMed:14739602, ECO:0000269|
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05458	Siva	1 → 175	Cd27 binding protein (Siva)	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Mostly expressed in thymus, testis, ovary, prostate, small intestine and spleen and less in colon.
• Sequence:

  MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDE
  GCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRA
  VDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

• Sequence length: 175

Pathways

KEGG Pathway:

p53 signaling pathway

Related Genes

No strongly related genes found yet for SIVA1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SIVA1.