SIRT6 (sirtuin 6)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51548
• Gene name: Sirtuin 6
• Gene symbol: SIRT6
• Synonyms (NCBI Gene): SIR2L6, hSIRT6
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase

miRNA Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439627	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT735225	hsa-miR-186-5p	Western blotting, qRT-PCR	32573339
MIRT1350318	hsa-miR-1224-5p	CLIP-seq
MIRT1350319	hsa-miR-3180-5p	CLIP-seq
MIRT1350320	hsa-miR-33a	CLIP-seq
MIRT1350321	hsa-miR-33b	CLIP-seq
MIRT1350322	hsa-miR-3915	CLIP-seq
MIRT1350323	hsa-miR-4689	CLIP-seq
MIRT1350324	hsa-miR-4751	CLIP-seq
MIRT1350325	hsa-miR-520a-5p	CLIP-seq
MIRT1350326	hsa-miR-525-5p	CLIP-seq
MIRT1350327	hsa-miR-1321	CLIP-seq
MIRT1350328	hsa-miR-1915	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350331	hsa-miR-4270	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT1350333	hsa-miR-4441	CLIP-seq
MIRT1350334	hsa-miR-4739	CLIP-seq
MIRT1350335	hsa-miR-4756-5p	CLIP-seq
MIRT2103776	hsa-miR-130a	CLIP-seq
MIRT2103777	hsa-miR-130b	CLIP-seq
MIRT2103778	hsa-miR-148a	CLIP-seq
MIRT2103779	hsa-miR-148b	CLIP-seq
MIRT2103780	hsa-miR-152	CLIP-seq
MIRT2103781	hsa-miR-2682	CLIP-seq
MIRT2103782	hsa-miR-301a	CLIP-seq
MIRT2103783	hsa-miR-301b	CLIP-seq
MIRT2103784	hsa-miR-34a	CLIP-seq
MIRT2103785	hsa-miR-34c-5p	CLIP-seq
MIRT2103786	hsa-miR-3666	CLIP-seq
MIRT2103787	hsa-miR-3714	CLIP-seq
MIRT2103788	hsa-miR-4295	CLIP-seq
MIRT2103789	hsa-miR-449a	CLIP-seq
MIRT2103790	hsa-miR-449b	CLIP-seq
MIRT2103791	hsa-miR-449c	CLIP-seq
MIRT2103792	hsa-miR-454	CLIP-seq
MIRT2103793	hsa-miR-548an	CLIP-seq
MIRT2622898	hsa-miR-326	CLIP-seq
MIRT2622899	hsa-miR-330-5p	CLIP-seq
MIRT1350329	hsa-miR-331-3p	CLIP-seq
MIRT2622900	hsa-miR-342-5p	CLIP-seq
MIRT1350330	hsa-miR-4254	CLIP-seq
MIRT1350332	hsa-miR-4308	CLIP-seq
MIRT2622901	hsa-miR-4455	CLIP-seq
MIRT2622902	hsa-miR-4474-3p	CLIP-seq
MIRT2622903	hsa-miR-4651	CLIP-seq
MIRT2622904	hsa-miR-4664-5p	CLIP-seq
MIRT2622905	hsa-miR-4667-5p	CLIP-seq
MIRT2622906	hsa-miR-4700-5p	CLIP-seq
MIRT2622907	hsa-miR-4778-3p	CLIP-seq
MIRT2622908	hsa-miR-608	CLIP-seq
MIRT2622909	hsa-miR-637	CLIP-seq
MIRT2622910	hsa-miR-644	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXO3	Activation	20816089

Gene ontology (GO) Show/Hide all (167)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	24043303
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000785	Component	Chromatin	IDA	23892288, 27043296, 27912097, 30374165, 33067423
GO:0000785	Component	Chromatin	IDA	26456828
GO:0000785	Component	Chromatin	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	33067423
GO:0003682	Function	Chromatin binding	IDA	27043296, 27912097
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	IMP	33067423
GO:0003684	Function	Damaged DNA binding	IDA	31995034, 32538779
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0005515	Function	Protein binding	IPI	19135889, 23217706, 23911928
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26898756, 29555651
GO:0005634	Component	Nucleus	IDA	25819580, 26456828
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA	16079181
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005721	Component	Pericentric heterochromatin	IDA	27043296
GO:0005730	Component	Nucleolus	IDA	16079181
GO:0005783	Component	Endoplasmic reticulum	IDA	23552949
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006094	Process	Gluconeogenesis	IDA	16753578
GO:0006096	Process	Glycolytic process	IDA	20847263
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006284	Process	Base-excision repair	IEA
GO:0006302	Process	Double-strand break repair	IDA	28190768, 32028527
GO:0006302	Process	Double-strand break repair	IDA	21680843, 27568560
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	23892288
GO:0006338	Process	Chromatin remodeling	IDA	23892288, 33067423, 37023208
GO:0006476	Process	Protein deacetylation	IMP	27457971
GO:0006606	Process	Protein import into nucleus	IDA	20117128
GO:0006606	Process	Protein import into nucleus	IMP	20117128
GO:0006954	Process	Inflammatory response	IDA	21147091, 22267480
GO:0006974	Process	DNA damage response	IEA
GO:0007265	Process	Ras protein signal transduction	IDA	31130282
GO:0008270	Function	Zinc ion binding	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0008340	Process	Determination of adult lifespan	IMP	25541994
GO:0009411	Process	Response to UV	IDA	19109893
GO:0010526	Process	Transposable element silencing	IEA
GO:0010526	Process	Transposable element silencing	ISS
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IDA	19135889, 22753495
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	24043303, 27912097
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	ISS
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0030234	Function	Enzyme regulator activity	IDA	32538779
GO:0031490	Function	Chromatin DNA binding	IDA	33067423
GO:0031491	Function	Nucleosome binding	IDA	23892288, 33067423
GO:0031491	Function	Nucleosome binding	IMP	33067423
GO:0031508	Process	Pericentric heterochromatin formation	IDA	27043296
GO:0031509	Process	Subtelomeric heterochromatin formation	IMP	21847107
GO:0031648	Process	Protein destabilization	IDA	29474172
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	IMP	29474172
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0032129	Function	Histone H3K9 deacetylase activity, hydrolytic mechanism	EXP	33067423
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	23201774, 25819580
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	27457971
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IEA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	ISS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IDA	19109893, 23142079, 24052263, 25009184, 26787900, 27322069, 29474172
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0035033	Function	Histone deacetylase regulator activity	IDA	31995034, 32538779
GO:0035861	Component	Site of double-strand break	IDA	21680843, 23911928, 27568560, 31995034, 32538779
GO:0042181	Process	Ketone biosynthetic process	IEA
GO:0042181	Process	Ketone biosynthetic process	ISS
GO:0042308	Process	Negative regulation of protein import into nucleus	IEA
GO:0042308	Process	Negative regulation of protein import into nucleus	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	31995034, 32538779
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	16753578
GO:0045721	Process	Negative regulation of gluconeogenesis	IDA	23142079, 25009184
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	17024043
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IMP	21847107
GO:0045820	Process	Negative regulation of glycolytic process	IDA	26456828
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22901803, 24120661
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	25009184, 26787900
GO:0046827	Process	Positive regulation of protein export from nucleus	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IBA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IDA	18337721, 23892288, 26456828, 30374165, 33067423
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IMP	29555651
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0050708	Process	Regulation of protein secretion	IDA	23552949
GO:0050994	Process	Regulation of lipid catabolic process	IEA
GO:0050994	Process	Regulation of lipid catabolic process	ISS
GO:0051697	Process	Protein delipidation	IDA	23552949
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	ISS
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	28190768
GO:0070403	Function	NAD+ binding	IEA
GO:0070403	Function	NAD+ binding	ISS
GO:0090734	Component	Site of DNA damage	IDA	19109893
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IDA	27043296
GO:0097372	Function	Histone H3K18 deacetylase activity, NAD-dependent	IEA
GO:0099115	Component	Chromosome, subtelomeric region	IDA	18337721
GO:0106274	Function	NAD+-protein-arginine ADP-ribosyltransferase activity	IEA
GO:0106274	Function	NAD+-protein-arginine ADP-ribosyltransferase activity	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	28723567
GO:0120186	Process	Negative regulation of protein localization to chromatin	IDA	27912097
GO:0120187	Process	Positive regulation of protein localization to chromatin	IEA
GO:0120187	Process	Positive regulation of protein localization to chromatin	ISS
GO:0140612	Function	DNA damage sensor activity	IDA	31995034, 32538779
GO:0140765	Function	Histone H3K56 deacetylase activity, NAD-dependent	IDA	23911928, 26456828, 26898756, 27912097, 30374165
GO:0140765	Function	Histone H3K56 deacetylase activity, NAD-dependent	IEA
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IDA	23552949, 24052263, 26456828, 27322069, 30374165, 31995034
GO:0140773	Function	NAD-dependent protein demyristoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IDA	23552949, 24052263, 27322069, 28406396
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IEA
GO:0140774	Function	NAD-dependent protein depalmitoylase activity	IMP	29555651
GO:0140804	Function	NAD+-protein-lysine ADP-ribosyltransferase activity	IEA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IEA
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	14701750
GO:1902459	Process	Positive regulation of stem cell population maintenance	IDA	27912097
GO:1902732	Process	Positive regulation of chondrocyte proliferation	IMP	25819580
GO:1903076	Process	Regulation of protein localization to plasma membrane	IDA	28406396
GO:1904841	Function	TORC2 complex binding	IEA
GO:1904841	Function	TORC2 complex binding	ISS
GO:1905555	Process	Positive regulation of blood vessel branching	IMP	23201774
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IMP	23201774
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560
GO:1990166	Process	Protein localization to site of double-strand break	IDA	27568560
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	21680843, 22753495, 27322069, 27568560
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IEA
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	IDA	27912097
GO:2000738	Process	Positive regulation of stem cell differentiation	IDA	27912097
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	ISS
GO:2000773	Process	Negative regulation of cellular senescence	IDA	22753495, 27043296
GO:2000773	Process	Negative regulation of cellular senescence	IMP	29474172
GO:2000774	Process	Positive regulation of cellular senescence	IDA	29474172
GO:2000781	Process	Positive regulation of double-strand break repair	IDA	23911928, 31995034, 32538779
GO:2000781	Process	Positive regulation of double-strand break repair	IEA

Other IDs

• MIM: 606211
• HGNC: 14934
• e!Ensembl: ENSG00000077463

Protein

• UniProt ID: Q8N6T7
• Protein name: NAD-dependent protein deacylase sirtuin-6 (EC 2.3.1.-) (NAD-dependent protein deacetylase sirtuin-6) (EC 2.3.1.286) (Protein mono-ADP-ribosyltransferase sirtuin-6) (EC 2.4.2.-) (Regulatory protein SIR2 homolog 6) (hSIRT6) (SIR2-like protein 6)
• Protein function: NAD-dependent protein deacetylase, deacylase and mono-ADP-ribosyltransferase that plays an essential role in DNA damage repair, telomere maintenance, metabolic homeostasis, inflammation, tumorigenesis and aging (PubMed:18337721, PubMed:19135889,
• PDB: 3K35 , 3PKI , 3PKJ , 3ZG6 , 5MF6 , 5MFP , 5MFZ , 5MGN , 5X16 , 5Y2F , 6HOY , 6QCD , 6QCE , 6QCH , 6QCJ , 6XUY , 6XV1 , 6XV6 , 6XVG , 6ZU4 , 7CL0 , 7CL1 , 8AK5 , 8AK6 , 8AK7 , 8AK8 , 8AK9 , 8AKA , 8AKB , 8AKC , 8AKD , 8AKE , 8AKF , 8AKG , 8BL0 , 8BL1 , 8CNM , 8CNO , 8F86 , 8G57 , 8I2B , 8OF4 , 9G7H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	81 → 221	Sir2 family	Family
  PF02146	SIR2	52 → 87	Sir2 family	Family

• Sequence:

  MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
  IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
  RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
  LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
  LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
  EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

• Sequence length: 355

Pathways

KEGG Pathway	Reactome Pathway
Nicotinate and nicotinamide metabolism	Processing of DNA double-strand break ends
Metabolic pathways
Thermogenesis
Central carbon metabolism in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Premature ovarian failure	Likely pathogenic	rs771714154	RCV001270238	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (9)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CARDIOMEGALY	—	CTD	22335191, 35798905	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	28536482	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	35798905	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Uncertain significance	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
OVARIAN FAILURE, PREMATURE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	34713381	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	34713381	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (208)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27766571, 27864740		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31128573		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	30989475		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31295533		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	28786706		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30989475		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33910019	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30841754		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27180906		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30189861		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30189861		★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	38365109	Inhibit	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30989475		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27045575, 27249230, 28296196, 31063699		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23553536, 31661005		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	27496874	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	30237540, 30504065		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31542484		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27045575, 27249230, 28296196, 31063699		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28296196, 33952798, 36733404	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25400728		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	31701920	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23514751, 23911928, 24842653, 25074979, 25808624, 27746184, 28228253, 31357743		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25808624, 27746184, 32681437, 35840633	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23800187, 26675349, 35840633, 37566546	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29790697, 30524965		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26631040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30542728, 31257493, 31842909, 36124029, 36308411, 36534275, 37715252, 37763801	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25400728		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23526469, 25197348, 28443459, 29125477		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26121130	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37096064	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31696978		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31572453		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26886147, 27045575, 27829173, 28659816, 28661724, 30574122, 31759967		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28296196	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	22087257	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	22087257	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31603194		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	21331741		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24367027, 27767101		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28685526		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29387864, 29474172		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33634990	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29227545, 29512698, 29957460, 30504065, 31149050		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29552180, 30333863		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26657850, 27923994, 30504065, 36807774	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27045575, 28659816		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28935184		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	27118880		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27118880		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27118880, 35224092	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27118880		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26639398, 29286133, 30429089, 31464310		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30309657		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31696978		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29177584, 29535637, 29966233, 31318577		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29177584, 29197589, 29371988, 29535637, 29966233, 31318577		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34500107	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33096729, 34500107	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28215636, 29352194		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21331741, 28386046, 28765271, 29177584, 29197589, 30078674, 30987683		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31318577		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33096729	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31115579		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	25162034, 29049850		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25162034	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38222451	Inhibit	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	27357320		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26332421	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	31759967		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26183563		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26183563, 34927546	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31906251	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28653878		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28653878		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28653878	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28653878	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20816089, 29535637, 29698567, 30078674, 31541078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	20816089, 28536120, 30078674		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26648570, 31004738		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26648570, 31004738		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24607900, 26648570, 28677777, 29659670		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29659670	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31321952	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30135584, 30926765		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29790697	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29069788, 29966233		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27045575, 28659816		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27766571, 27864740		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	27766571	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28786706		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23373812		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30078674		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30987683		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30894089, 31265839		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	23526469		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21224216	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28977842, 30230565, 30390331		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36534275	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28215636, 29352194		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	34531509	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	28215636, 29352194		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28951325, 31603194		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30651359		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	30070973		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28871079, 31787254		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29373150, 30700227		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21331741		★☆☆☆☆ Found in Text Mining only
Lethal brain and heart developmental defects	Lethal Brain And Heart Developmental Defects	Orphanet			★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27766571, 29025907		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31928132, 32587297	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27766571, 27864740, 32587297	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30587342		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	30504065		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23526469, 24366394, 25181338, 25683165, 26748705, 26861461, 27041572, 28238784, 29100306, 29217762, 29535552, 29563873, 30374165, 31257493, 31551254, 31842909		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	36534275	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25197348, 25713071, 29125477	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28653878	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29363378	Associate	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	16439206, 28860594		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23514751, 23911928, 24842653, 25074979, 25808624, 28228253, 31357743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26183563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28653878		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23041974, 23526469, 30542728		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23526469, 25197348, 28443459, 29125477		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30524965, 31572453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27180906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23982738		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	25320180, 31696978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28656307, 29088792		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25400728		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23217706, 23526469, 23982738, 25320180, 25503141, 26456828, 26648570, 26861461, 27180906, 27836583, 28228253, 28386046, 28393212, 28685526, 28958848, 29177584, 29215322, 29217762, 29227545, 29363378, 29515203, 30034937, 30078674, 30243709, 30250025, 30333863, 30464510, 30514106, 30651359, 30655890, 30671172, 31149050, 31591350, 31696978		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24332849, 29227545, 29512698, 29957460, 30504065, 31149050		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	29215322		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29215322, 30143629, 31696978		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29215322	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32789493	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30309657		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27836583, 28250020, 29177584, 29233643, 29319170, 29515203, 30078674, 30530497		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	29515203	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29215322		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	27043296	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26675349, 30402853	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30402853		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	26886147		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	30845774	Inhibit	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29371988		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26803106		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30464510		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23217706, 23514751, 23526469, 23982738, 24332849, 24366394, 24607900, 25074979, 25085992, 25320180, 25400728, 25683165, 25808624, 26183563, 26456828, 26648570, 26861461, 26898756, 27045575, 28228253, 28406396, 28653878, 28656307, 28935184, 29125477, 29217762, 29227545, 29552180, 29957460, 30034937, 30333863, 30457131, 30655890, 30989475, 31149050, 31257493, 31591350, 31696978, 31842909		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28951325, 29374686		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31541078		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25197348, 25227832, 28904859, 29204192, 29363378, 30577808		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28536120		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	24842653		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26748705, 27118880, 28250020, 28607107, 29177584, 29535637, 30671172, 31113929, 31318577		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27118880, 35811457	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30845774	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36496445	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30030453, 30787391, 31701920		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30787391, 31477582, 31701920		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31477582, 31701920	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28904859, 30483801, 30655890, 31626739		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34359939	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31572453		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25807436	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32541517, 35686673	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27180906		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27180906		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28393212, 30675128, 31114231		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34021216	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	28039864		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35249460	Associate	★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	18337721		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23982738		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23982738		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23982738, 33282964	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	27496874	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33143333	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24367027, 27767101	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28385812, 31005557		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28935184		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31787254		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23553536, 24638860, 30429089		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	30651359	Inhibit	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25404738, 28887543, 30203196, 30700227		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	31017270		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	31552414	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	35686673	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	24842653		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23860128, 31696978		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23475622	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25320180		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25503141		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20816089, 28536120, 29535637, 29698567, 30078674, 31541078		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28656307, 29088792		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30791908		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	18337721, 25819580	Associate	★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	33568575	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35136826	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25400728	Inhibit	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	25400728		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32066835	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23132960	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	23132960	Inhibit	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	18337721		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	18337721	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

DHRS7 2 shared diseasesFatty liver, Fatty liver, alcoholic 3 shared evidence sourcesDisgenet (Fatty liver), CTD (Fatty liver), Disgenet (Fatty liver, alcoholic) Related via 2 shared diseases including Fatty liver, Fatty liver, alcoholic — evidence mostly Disgenet. HAS3 2 shared diseasesFatty liver, Fatty liver, alcoholic 3 shared evidence sourcesDisgenet (Fatty liver), CTD (Fatty liver), Disgenet (Fatty liver, alcoholic) Related via 2 shared diseases including Fatty liver, Fatty liver, alcoholic — evidence mostly Disgenet. PLIN2 2 shared diseasesFatty liver, Fatty liver, alcoholic 3 shared evidence sourcesDisgenet (Fatty liver), CTD (Fatty liver), Disgenet (Fatty liver, alcoholic) Related via 2 shared diseases including Fatty liver, Fatty liver, alcoholic — evidence mostly Disgenet. GPD1L 3 shared diseasesLong qt syndrome, Fatty liver, Fatty liver, alcoholic 4 shared evidence sourcesDisgenet (Long qt syndrome), Disgenet (Fatty liver), CTD (Fatty liver), Disgenet (Fatty liver, alcoholic) Related via 3 shared diseases including Long qt syndrome, Fatty liver — evidence mostly Disgenet. ATP5IF1 2 shared diseasesFatty liver, Fatty liver, alcoholic 3 shared evidence sourcesDisgenet (Fatty liver), CTD (Fatty liver), Disgenet (Fatty liver, alcoholic) Related via 2 shared diseases including Fatty liver, Fatty liver, alcoholic — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DHRS7	2	["Fatty liver","Fatty liver, alcoholic"]	0	[]	3	["Disgenet (Fatty liver)","CTD (Fatty liver)","Disgenet (Fatty liver, alcoholic)"]
HAS3	2	["Fatty liver","Fatty liver, alcoholic"]	0	[]	3	["Disgenet (Fatty liver)","CTD (Fatty liver)","Disgenet (Fatty liver, alcoholic)"]
PLIN2	2	["Fatty liver","Fatty liver, alcoholic"]	0	[]	3	["Disgenet (Fatty liver)","CTD (Fatty liver)","Disgenet (Fatty liver, alcoholic)"]
GPD1L	3	["Long qt syndrome","Fatty liver","Fatty liver, alcoholic"]	0	[]	4	["Disgenet (Long qt syndrome)","Disgenet (Fatty liver)","CTD (Fatty liver)","Disgenet (Fatty liver, alcoholic)"]
ATP5IF1	2	["Fatty liver","Fatty liver, alcoholic"]	0	[]	3	["Disgenet (Fatty liver)","CTD (Fatty liver)","Disgenet (Fatty liver, alcoholic)"]

Diseases Linked via Similar Genes

Atrial fibrillation Linked via 1 of 5 related genesHAS3 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesHAS3 Stomach neoplasms Linked via 1 of 5 related genesPLIN2 Brugada syndrome Linked via 1 of 5 related genesGPD1L Dilated cardiomyopathy Linked via 1 of 5 related genesGPD1L

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Atrial fibrillation	1	["HAS3"]
Attention deficit hyperactivity disorder	1	["HAS3"]
Stomach neoplasms	1	["PLIN2"]
Brugada syndrome	1	["GPD1L"]
Dilated cardiomyopathy	1	["GPD1L"]