SIGLEC12 (sialic acid binding Ig like lectin 12)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 89858
Gene name Sialic acid binding Ig like lectin 12
Gene symbol SIGLEC12
Synonyms (NCBI Gene)
S2VSIGLECL1SLGSiglec-XII
Chromosome 19
Chromosome location 19q13.41
Summary Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on
miRNA miRNA information provided by mirtarbase database.
37 Show/Hide all (37)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT531195 hsa-miR-6777-5p PAR-CLIP 22012620
MIRT531194 hsa-miR-6889-5p PAR-CLIP 22012620
MIRT531193 hsa-miR-6089 PAR-CLIP 22012620
MIRT531192 hsa-miR-574-5p PAR-CLIP 22012620
MIRT531191 hsa-miR-4706 PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0007155 Process Cell adhesion IBA
GO:0007155 Process Cell adhesion IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606094 15482 ENSG00000254521
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96PQ1
Protein name Sialic acid-binding Ig-like lectin 12 (Siglec-12) (Sialic acid-binding Ig-like lectin-like 1) (Siglec-L1)
Protein function Putative adhesion molecule that mediates sialic-acid dependent binding to cells. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 27 → 142 Immunoglobulin V-set domain Domain
PF07686 V-set 154 → 269 Immunoglobulin V-set domain Domain
PF13927 Ig_3 380 → 450 Domain
Tissue specificity TISSUE SPECIFICITY: Isoform Short is highly expressed in spleen, small intestine and adrenal gland; it is lower expressed in thyroid, placenta, brain, stomach, bone marrow, spinal cord and breast. Isoform Long is highly expressed in spleen, small intestin
Sequence 
MLLLLLLLPPLLCGRVGAKEQKDYLLTMQKSVTVQEGLCVSVLCSFSYPQNGWTASDPVH
GYWFRAGDHVSRNIPVATNNPARAVQEETRDRFHLLGDPQNKDCTLSIRDTRESDAGTYV
FCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESVTVQEGLCVSVPCSVLYPHYNW
TASSPVYGSWFKEGADIPWDIPVATNTPSGKVQEDTHGRFLLLGDPQTNNCSLSIRDARK
GDSGKYYFQVERGSRKWNYIYDKLSVHVTALTHMPTFSIPGTLESGHPRNLTCSVPWACE
QGTPPTITWMGASVSSLDPTITRSSMLSLIPQPQDHGTSLTCQVTLPGAGVTMTRAVRLN
ISYPPQNLTMTVFQGDGTASTTLRNGSALSVLEGQSLHLVCAVDSNPPARLSWTWGSLTL
SPSQSSNLGVLELPRVHVKDEGEFTCRAQNPLGSQHISLSLSLQNEYTGKMRPISGVTLG
AFGGAGATALVFLYFCIIFVVVRSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESP
ADDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK
Sequence length 595
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

No strongly related genes found yet for SIGLEC12.

No additional diseases found yet through genes similar to SIGLEC12.