SIGIRR (single Ig and TIR domain containing)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 59307
• Gene name: Single Ig and TIR domain containing
• Gene symbol: SIGIRR
• Synonyms (NCBI Gene): IL-1R8, TIR8
• Chromosome: 11
• Chromosome location: 11p15.5

miRNA Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017017	hsa-miR-335-5p	Microarray	18185580
MIRT045553	hsa-miR-149-5p	CLASH	23622248
MIRT2103300	hsa-miR-1207-5p	CLIP-seq
MIRT2103301	hsa-miR-125a-5p	CLIP-seq
MIRT2103302	hsa-miR-125b	CLIP-seq
MIRT2103303	hsa-miR-1909	CLIP-seq
MIRT2103304	hsa-miR-1915	CLIP-seq
MIRT2103305	hsa-miR-3192	CLIP-seq
MIRT2103306	hsa-miR-3197	CLIP-seq
MIRT2103307	hsa-miR-3689a-3p	CLIP-seq
MIRT2103308	hsa-miR-3689c	CLIP-seq
MIRT2103309	hsa-miR-4319	CLIP-seq
MIRT2103310	hsa-miR-4446-3p	CLIP-seq
MIRT2103311	hsa-miR-4446-5p	CLIP-seq
MIRT2103312	hsa-miR-4649-3p	CLIP-seq
MIRT2103313	hsa-miR-4685-5p	CLIP-seq
MIRT2103314	hsa-miR-4717-5p	CLIP-seq
MIRT2103315	hsa-miR-4726-3p	CLIP-seq
MIRT2103316	hsa-miR-4728-5p	CLIP-seq
MIRT2103317	hsa-miR-4736	CLIP-seq
MIRT2103318	hsa-miR-4763-3p	CLIP-seq
MIRT2103319	hsa-miR-544b	CLIP-seq
MIRT2103301	hsa-miR-125a-5p	CLIP-seq
MIRT2103302	hsa-miR-125b	CLIP-seq
MIRT2103309	hsa-miR-4319	CLIP-seq
MIRT2103312	hsa-miR-4649-3p	CLIP-seq
MIRT2103314	hsa-miR-4717-5p	CLIP-seq
MIRT2103319	hsa-miR-544b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Activation	21077278

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	IEA
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	ISS
GO:0005515	Function	Protein binding	IPI	12925853, 21187075
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	IMP	10346978
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	TAS	15866876
GO:0032682	Process	Negative regulation of chemokine production	IEA
GO:0032682	Process	Negative regulation of chemokine production	ISS
GO:0045751	Process	Negative regulation of Toll signaling pathway	IMP	12925853
GO:2000660	Process	Negative regulation of interleukin-1-mediated signaling pathway	IEA

Other IDs

• MIM: 605478
• HGNC: 30575
• e!Ensembl: ENSG00000185187

Protein

• UniProt ID: Q6IA17
• Protein name: Single Ig IL-1-related receptor (Single Ig IL-1R-related molecule) (Single immunoglobulin domain-containing IL1R-related protein) (Toll/interleukin-1 receptor 8) (TIR8)
• Protein function: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01582	TIR	164 → 328	TIR domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in epithelial tissues such as kidney, lung and gut. {ECO:0000269|PubMed:14715412, ECO:0000269|PubMed:21077278}.
• Sequence:

  MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGG
  HYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVA
  AVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKF
  VNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSH
  SFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFW
  KEVQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGVRG
  PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

• Sequence length: 410

Pathways

Reactome Pathway

MyD88:MAL(TIRAP) cascade initiated on plasma membrane

Interleukin-37 signaling

Related Genes

No strongly related genes found yet for SIGIRR.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SIGIRR.