SHLD3 (shieldin complex subunit 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 112441434
• Gene name: Shieldin complex subunit 3
• Gene symbol: SHLD3
• Synonyms (NCBI Gene): CTC-534A2.2, RINN1
• Chromosome: 5
• Chromosome location: 5q12.3

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	NAS	29656893
GO:0002208	Process	Somatic diversification of immunoglobulins involved in immune response	NAS	29656893
GO:0005515	Function	Protein binding	IPI	29656893, 34354233
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IDA	29656893
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IEA
GO:0035861	Component	Site of double-strand break	IDA	29656893
GO:0035861	Component	Site of double-strand break	NAS	29656893
GO:0043247	Process	Telomere maintenance in response to DNA damage	NAS	29656893
GO:0045830	Process	Positive regulation of isotype switching	IBA
GO:0045830	Process	Positive regulation of isotype switching	IDA	29656893
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IBA
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	29656893
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	IBA
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	IDA	29656893
GO:2001034	Process	Positive regulation of double-strand break repair via nonhomologous end joining	NAS	29656893

Other IDs

• MIM: 618030
• HGNC: 53826
• e!Ensembl: ENSG00000253251

Protein

• UniProt ID: Q6ZNX1
• Protein name: Shieldin complex subunit 3 (REV7-interacting novel NHEJ regulator 1) (Shield complex subunit 3)
• Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) an
• PDB: 6K07 , 6K08 , 6KTO , 6M7A , 6M7B , 6VE5 , 6WW9 , 6WWA , 7L9P
• Sequence:

  MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVI
  SEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQ
  SEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQT
  LEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLF
  VHKYGVIFSM

• Sequence length: 250

Related Genes

No strongly related genes found yet for SHLD3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SHLD3.