SHISAL2B (shisa like 2B)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100132916
Gene name Shisa like 2B
Gene symbol SHISAL2B
Synonyms (NCBI Gene)
FAM159B
Chromosome 5
Chromosome location 5q12.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620219 34236 ENSG00000145642
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NKW6
Protein name Protein shisa-like-2B
Family and domains
Sequence 
MSEASRLCSGYYSLNQSFVEPFQCPRRGEGAALQYCCGFADLKYCCSEPGSYFPYKHSYM
WSLSIGALIGLGIAALVLLAFVISVCVLCYLFLYTKPQRLDTGLKLQHLEASSTQEGKSN
GKTKALNSNAASNATNETYYEADDIIQEKTMDATQIHIAY
Sequence length 160
Interactions View interactions

No strongly related genes found yet for SHISAL2B.

No additional diseases found yet through genes similar to SHISAL2B.