SHISA8 (shisa family member 8)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 440829
Gene name Shisa family member 8
Gene symbol SHISA8
Synonyms (NCBI Gene)
C22orf17Orf26
Chromosome 22
Chromosome location 22q13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0014069 Component Postsynaptic density IBA
GO:0016020 Component Membrane IEA
GO:0032281 Component AMPA glutamate receptor complex IBA
GO:0032591 Component Dendritic spine membrane IBA
GO:0045211 Component Postsynaptic membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617329 18351 ENSG00000234965
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B8ZZ34
Protein name Protein shisa-8 (Shisa family member 8)
Protein function May regulate trafficking and current kinetics of AMPA-type glutamate receptor (AMPAR) at synapses.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13908 Shisa 57 → 195 Wnt and FGF inhibitory regulator Family
Sequence 
MARAGARGLLGGRRPPGLRLALALRLALLLARPPSGRAGAPEAQGPAAPGTTAPEGGDRC
RGYYDVMGQWDPPFNCSSGAYSFCCGTCGYRFCCHDGPRRLDQSRCSNYDTPAWVQTGRP
PARARDTAAPRDPGRERSHTAVYAVCGVAALLVLAGIGARLGLERAHSPRARRTVTRALT
ELLKQPGPQEPLPPTLGPPLGGCVQVQMGDGLPRGSPHNSADKKRLNNAPRGSAAPGPPR
GPRLQGGGSLTLQPDYAKYATFKAAALKAAEAAPRDFCQRFPALEPSPRQPPARAPRPSP
DLPAPLDACPWAPPVYAPPAAPGPYAAWTSSRPARPAPLSHPTARAFQVPRRPGHAARRQ
FSVKMPETFNPQLPGLYGSAGRGSRYLRTNSKTEVTV
Sequence length 397
Interactions View interactions

No strongly related genes found yet for SHISA8.

No additional diseases found yet through genes similar to SHISA8.