SHD (Src homology 2 domain containing transforming protein D)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 56961
Gene name Src homology 2 domain containing transforming protein D
Gene symbol SHD
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001784 Function Phosphotyrosine residue binding IBA
GO:0005515 Function Protein binding IPI 24728074, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610481 30633 ENSG00000105251
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96IW2
Protein name SH2 domain-containing adapter protein D
Protein function May function as an adapter protein.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 240 → 316 SH2 domain Domain
Sequence 
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGP
GDSKNPGDAKYGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYLDPFDAQPHPAPPD
DGYMEPYDAQWVMSELPGRGVQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADE
YDQPWEWKKDHISRAFAVQFDSPEWERTPGSAKELRRPPPRSPQPAERVDPALPLEKQPW
FHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRSSQGFLHLKFARTRENQVVLG
QHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP
Sequence length 340
Interactions View interactions

No strongly related genes found yet for SHD.

No additional diseases found yet through genes similar to SHD.