SHC1 (SHC adaptor protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6464
• Gene name: SHC adaptor protein 1
• Gene symbol: SHC1
• Synonyms (NCBI Gene): SHC, SHCA
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen

miRNA Show/Hide all (536)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016646	hsa-miR-429	Reporter assay	20005803
MIRT020350	hsa-miR-200a-3p	Reporter assay	20005803
MIRT021079	hsa-miR-200c-3p	Reporter assay	20005803
MIRT021650	hsa-miR-141-3p	Reporter assay	20005803
MIRT023035	hsa-miR-124-3p	Microarray	18668037
MIRT024134	hsa-miR-200b-3p	Reporter assay	20005803
MIRT046156	hsa-miR-30b-5p	CLASH	23622248
MIRT438197	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT438197	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT438183	hsa-miR-365a-3p	Microarray, Western blot	24216611
MIRT438197	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT438197	hsa-miR-27b-3p	Luciferase reporter assay	24177325
MIRT438183	hsa-miR-365a-3p	Microarray, Western blot	24216611
MIRT732288	hsa-miR-5582-5p	Luciferase reporter assay, qRT-PCR, Western blot	27475256
MIRT732288	hsa-miR-5582-5p	Luciferase reporter assay, qRT-PCR, Western blot	27475256
MIRT732288	hsa-miR-5582-5p	Luciferase reporter assay, qRT-PCR, Western blot	27475256
MIRT732288	hsa-miR-5582-5p	Luciferase reporter assay, qRT-PCR, Western blot	27475256
MIRT735655	hsa-miR-203a-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32781430
MIRT736626	hsa-miR-219a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31428222
MIRT021650	hsa-miR-141-3p	Microarray, qRT-PCR	35816043
MIRT016646	hsa-miR-429	Microarray, qRT-PCR	35816043
MIRT1346400	hsa-miR-1207-5p	CLIP-seq
MIRT1346401	hsa-miR-1229	CLIP-seq
MIRT1346402	hsa-miR-1321	CLIP-seq
MIRT1346403	hsa-miR-134	CLIP-seq
MIRT1346404	hsa-miR-1827	CLIP-seq
MIRT1346405	hsa-miR-2467-3p	CLIP-seq
MIRT1346406	hsa-miR-2861	CLIP-seq
MIRT1346407	hsa-miR-3118	CLIP-seq
MIRT1346408	hsa-miR-3136-3p	CLIP-seq
MIRT1346409	hsa-miR-3154	CLIP-seq
MIRT1346410	hsa-miR-3188	CLIP-seq
MIRT1346411	hsa-miR-3192	CLIP-seq
MIRT1346412	hsa-miR-3202	CLIP-seq
MIRT1346413	hsa-miR-3612	CLIP-seq
MIRT1346414	hsa-miR-3679-3p	CLIP-seq
MIRT1346415	hsa-miR-375	CLIP-seq
MIRT1346416	hsa-miR-3978	CLIP-seq
MIRT1346417	hsa-miR-4257	CLIP-seq
MIRT1346418	hsa-miR-4325	CLIP-seq
MIRT1346419	hsa-miR-4424	CLIP-seq
MIRT1346420	hsa-miR-4433	CLIP-seq
MIRT1346421	hsa-miR-4436b-3p	CLIP-seq
MIRT1346422	hsa-miR-4436b-5p	CLIP-seq
MIRT1346423	hsa-miR-4443	CLIP-seq
MIRT1346424	hsa-miR-4446-3p	CLIP-seq
MIRT1346425	hsa-miR-4459	CLIP-seq
MIRT1346426	hsa-miR-4476	CLIP-seq
MIRT1346427	hsa-miR-4668-3p	CLIP-seq
MIRT1346428	hsa-miR-4739	CLIP-seq
MIRT1346429	hsa-miR-4756-5p	CLIP-seq
MIRT1346430	hsa-miR-4763-3p	CLIP-seq
MIRT1346431	hsa-miR-4768-3p	CLIP-seq
MIRT1346432	hsa-miR-4786-3p	CLIP-seq
MIRT1346433	hsa-miR-4793-3p	CLIP-seq
MIRT1346434	hsa-miR-650	CLIP-seq
MIRT1346435	hsa-miR-940	CLIP-seq
MIRT1346436	hsa-miR-943	CLIP-seq
MIRT1346400	hsa-miR-1207-5p	CLIP-seq
MIRT1346402	hsa-miR-1321	CLIP-seq
MIRT1346404	hsa-miR-1827	CLIP-seq
MIRT1346437	hsa-miR-200b	CLIP-seq
MIRT1346438	hsa-miR-200c	CLIP-seq
MIRT1346405	hsa-miR-2467-3p	CLIP-seq
MIRT1346410	hsa-miR-3188	CLIP-seq
MIRT1346412	hsa-miR-3202	CLIP-seq
MIRT1346439	hsa-miR-323-3p	CLIP-seq
MIRT1346413	hsa-miR-3612	CLIP-seq
MIRT1346440	hsa-miR-3664-5p	CLIP-seq
MIRT1346441	hsa-miR-374c	CLIP-seq
MIRT1346442	hsa-miR-376c	CLIP-seq
MIRT1346443	hsa-miR-409-3p	CLIP-seq
MIRT1346418	hsa-miR-4325	CLIP-seq
MIRT1346421	hsa-miR-4436b-3p	CLIP-seq
MIRT1346424	hsa-miR-4446-3p	CLIP-seq
MIRT1346425	hsa-miR-4459	CLIP-seq
MIRT1346426	hsa-miR-4476	CLIP-seq
MIRT1346428	hsa-miR-4739	CLIP-seq
MIRT1346429	hsa-miR-4756-5p	CLIP-seq
MIRT1346430	hsa-miR-4763-3p	CLIP-seq
MIRT1346433	hsa-miR-4793-3p	CLIP-seq
MIRT1346434	hsa-miR-650	CLIP-seq
MIRT1346444	hsa-miR-655	CLIP-seq
MIRT1346445	hsa-miR-9	CLIP-seq
MIRT1346435	hsa-miR-940	CLIP-seq
MIRT1346401	hsa-miR-1229	CLIP-seq
MIRT1346446	hsa-miR-124	CLIP-seq
MIRT1346447	hsa-miR-1273f	CLIP-seq
MIRT1346448	hsa-miR-139-5p	CLIP-seq
MIRT1346449	hsa-miR-150	CLIP-seq
MIRT1346450	hsa-miR-153	CLIP-seq
MIRT1346451	hsa-miR-186	CLIP-seq
MIRT1346452	hsa-miR-1912	CLIP-seq
MIRT1346453	hsa-miR-219-5p	CLIP-seq
MIRT1346454	hsa-miR-299-3p	CLIP-seq
MIRT1346455	hsa-miR-3148	CLIP-seq
MIRT1346456	hsa-miR-3151	CLIP-seq
MIRT1346457	hsa-miR-3163	CLIP-seq
MIRT1346458	hsa-miR-3171	CLIP-seq
MIRT1346459	hsa-miR-3180	CLIP-seq
MIRT1346460	hsa-miR-3180-3p	CLIP-seq
MIRT1346461	hsa-miR-3196	CLIP-seq
MIRT1346462	hsa-miR-3613-3p	CLIP-seq
MIRT1346463	hsa-miR-3618	CLIP-seq
MIRT1346464	hsa-miR-365	CLIP-seq
MIRT1346465	hsa-miR-3656	CLIP-seq
MIRT1346466	hsa-miR-3684	CLIP-seq
MIRT1346416	hsa-miR-3978	CLIP-seq
MIRT1346467	hsa-miR-4261	CLIP-seq
MIRT1346468	hsa-miR-4447	CLIP-seq
MIRT1346469	hsa-miR-4450	CLIP-seq
MIRT1346470	hsa-miR-4472	CLIP-seq
MIRT1346471	hsa-miR-4474-5p	CLIP-seq
MIRT1346472	hsa-miR-448	CLIP-seq
MIRT1346473	hsa-miR-4488	CLIP-seq
MIRT1346474	hsa-miR-4491	CLIP-seq
MIRT1346475	hsa-miR-4657	CLIP-seq
MIRT1346476	hsa-miR-4697-5p	CLIP-seq
MIRT1346477	hsa-miR-4749-3p	CLIP-seq
MIRT1346478	hsa-miR-4782-3p	CLIP-seq
MIRT1346479	hsa-miR-4786-5p	CLIP-seq
MIRT1346480	hsa-miR-491-5p	CLIP-seq
MIRT1346481	hsa-miR-494	CLIP-seq
MIRT1346482	hsa-miR-506	CLIP-seq
MIRT1346483	hsa-miR-548a-3p	CLIP-seq
MIRT1346484	hsa-miR-548an	CLIP-seq
MIRT1346485	hsa-miR-548e	CLIP-seq
MIRT1346486	hsa-miR-548f	CLIP-seq
MIRT1346487	hsa-miR-561	CLIP-seq
MIRT1346488	hsa-miR-568	CLIP-seq
MIRT1346489	hsa-miR-586	CLIP-seq
MIRT1346490	hsa-miR-609	CLIP-seq
MIRT1346491	hsa-miR-618	CLIP-seq
MIRT1346492	hsa-miR-769-5p	CLIP-seq
MIRT1346493	hsa-miR-934	CLIP-seq
MIRT1346494	hsa-miR-1976	CLIP-seq
MIRT1346495	hsa-miR-22	CLIP-seq
MIRT1346496	hsa-miR-4252	CLIP-seq
MIRT1346497	hsa-miR-4722-3p	CLIP-seq
MIRT1346498	hsa-miR-483-3p	CLIP-seq
MIRT1346464	hsa-miR-365	CLIP-seq
MIRT1346471	hsa-miR-4474-5p	CLIP-seq
MIRT1346477	hsa-miR-4749-3p	CLIP-seq
MIRT2102495	hsa-miR-10a	CLIP-seq
MIRT2102496	hsa-miR-10b	CLIP-seq
MIRT2102497	hsa-miR-1205	CLIP-seq
MIRT2102498	hsa-miR-1207-3p	CLIP-seq
MIRT1346401	hsa-miR-1229	CLIP-seq
MIRT1346446	hsa-miR-124	CLIP-seq
MIRT1346447	hsa-miR-1273f	CLIP-seq
MIRT2102499	hsa-miR-1287	CLIP-seq
MIRT1346448	hsa-miR-139-5p	CLIP-seq
MIRT2102500	hsa-miR-140-3p	CLIP-seq
MIRT1346449	hsa-miR-150	CLIP-seq
MIRT1346404	hsa-miR-1827	CLIP-seq
MIRT1346452	hsa-miR-1912	CLIP-seq
MIRT2102501	hsa-miR-197	CLIP-seq
MIRT1346437	hsa-miR-200b	CLIP-seq
MIRT1346438	hsa-miR-200c	CLIP-seq
MIRT2102502	hsa-miR-203	CLIP-seq
MIRT2102503	hsa-miR-2110	CLIP-seq
MIRT1346453	hsa-miR-219-5p	CLIP-seq
MIRT1346406	hsa-miR-2861	CLIP-seq
MIRT1346454	hsa-miR-299-3p	CLIP-seq
MIRT2102504	hsa-miR-3119	CLIP-seq
MIRT2102505	hsa-miR-3120-3p	CLIP-seq
MIRT2102506	hsa-miR-3127-5p	CLIP-seq
MIRT2102507	hsa-miR-3135	CLIP-seq
MIRT2102508	hsa-miR-3140-3p	CLIP-seq
MIRT2102509	hsa-miR-3150a-3p	CLIP-seq
MIRT1346456	hsa-miR-3151	CLIP-seq
MIRT1346409	hsa-miR-3154	CLIP-seq
MIRT2102510	hsa-miR-3162-5p	CLIP-seq
MIRT1346457	hsa-miR-3163	CLIP-seq
MIRT2102511	hsa-miR-3173-3p	CLIP-seq
MIRT1346459	hsa-miR-3180	CLIP-seq
MIRT1346460	hsa-miR-3180-3p	CLIP-seq
MIRT2102512	hsa-miR-3184	CLIP-seq
MIRT1346411	hsa-miR-3192	CLIP-seq
MIRT1346461	hsa-miR-3196	CLIP-seq
MIRT2102513	hsa-miR-3201	CLIP-seq
MIRT1346412	hsa-miR-3202	CLIP-seq
MIRT1346439	hsa-miR-323-3p	CLIP-seq
MIRT2102514	hsa-miR-335	CLIP-seq
MIRT2102515	hsa-miR-3607-3p	CLIP-seq
MIRT1346413	hsa-miR-3612	CLIP-seq
MIRT1346463	hsa-miR-3618	CLIP-seq
MIRT2102516	hsa-miR-3650	CLIP-seq
MIRT1346465	hsa-miR-3656	CLIP-seq
MIRT2102517	hsa-miR-3664-3p	CLIP-seq
MIRT1346440	hsa-miR-3664-5p	CLIP-seq
MIRT2102518	hsa-miR-3665	CLIP-seq
MIRT1346414	hsa-miR-3679-3p	CLIP-seq
MIRT2102519	hsa-miR-3689a-3p	CLIP-seq
MIRT2102520	hsa-miR-3689c	CLIP-seq
MIRT2102521	hsa-miR-371-5p	CLIP-seq
MIRT1346441	hsa-miR-374c	CLIP-seq
MIRT1346415	hsa-miR-375	CLIP-seq
MIRT1346442	hsa-miR-376c	CLIP-seq
MIRT2102522	hsa-miR-3922-5p	CLIP-seq
MIRT2102523	hsa-miR-3929	CLIP-seq
MIRT1346416	hsa-miR-3978	CLIP-seq
MIRT1346443	hsa-miR-409-3p	CLIP-seq
MIRT2102524	hsa-miR-423-5p	CLIP-seq
MIRT1346417	hsa-miR-4257	CLIP-seq
MIRT2102525	hsa-miR-4281	CLIP-seq
MIRT2102526	hsa-miR-4314	CLIP-seq
MIRT2102527	hsa-miR-4320	CLIP-seq
MIRT1346418	hsa-miR-4325	CLIP-seq
MIRT2102528	hsa-miR-4418	CLIP-seq
MIRT2102529	hsa-miR-4419b	CLIP-seq
MIRT1346420	hsa-miR-4433	CLIP-seq
MIRT2102530	hsa-miR-4436a	CLIP-seq
MIRT1346422	hsa-miR-4436b-5p	CLIP-seq
MIRT1346424	hsa-miR-4446-3p	CLIP-seq
MIRT1346468	hsa-miR-4447	CLIP-seq
MIRT1346469	hsa-miR-4450	CLIP-seq
MIRT2102531	hsa-miR-4452	CLIP-seq
MIRT2102532	hsa-miR-4457	CLIP-seq
MIRT1346425	hsa-miR-4459	CLIP-seq
MIRT1346470	hsa-miR-4472	CLIP-seq
MIRT1346426	hsa-miR-4476	CLIP-seq
MIRT2102533	hsa-miR-4478	CLIP-seq
MIRT1346472	hsa-miR-448	CLIP-seq
MIRT2102534	hsa-miR-4480	CLIP-seq
MIRT1346473	hsa-miR-4488	CLIP-seq
MIRT1346474	hsa-miR-4491	CLIP-seq
MIRT2102535	hsa-miR-4505	CLIP-seq
MIRT2102536	hsa-miR-450a	CLIP-seq
MIRT2102537	hsa-miR-4511	CLIP-seq
MIRT2102538	hsa-miR-4646-5p	CLIP-seq
MIRT1346475	hsa-miR-4657	CLIP-seq
MIRT2102539	hsa-miR-4695-5p	CLIP-seq
MIRT1346476	hsa-miR-4697-5p	CLIP-seq
MIRT2102540	hsa-miR-4700-3p	CLIP-seq
MIRT2102541	hsa-miR-4710	CLIP-seq
MIRT2102542	hsa-miR-4728-5p	CLIP-seq
MIRT2102543	hsa-miR-4731-3p	CLIP-seq
MIRT2102544	hsa-miR-4740-3p	CLIP-seq
MIRT2102545	hsa-miR-4753-5p	CLIP-seq
MIRT1346431	hsa-miR-4768-3p	CLIP-seq
MIRT1346478	hsa-miR-4782-3p	CLIP-seq
MIRT1346432	hsa-miR-4786-3p	CLIP-seq
MIRT2102546	hsa-miR-4791	CLIP-seq
MIRT1346433	hsa-miR-4793-3p	CLIP-seq
MIRT2102547	hsa-miR-4801	CLIP-seq
MIRT1346480	hsa-miR-491-5p	CLIP-seq
MIRT1346481	hsa-miR-494	CLIP-seq
MIRT1346482	hsa-miR-506	CLIP-seq
MIRT2102548	hsa-miR-509-3-5p	CLIP-seq
MIRT2102549	hsa-miR-509-5p	CLIP-seq
MIRT2102550	hsa-miR-510	CLIP-seq
MIRT2102551	hsa-miR-512-5p	CLIP-seq
MIRT2102552	hsa-miR-545	CLIP-seq
MIRT1346484	hsa-miR-548an	CLIP-seq
MIRT2102553	hsa-miR-548p	CLIP-seq
MIRT1346487	hsa-miR-561	CLIP-seq
MIRT2102554	hsa-miR-587	CLIP-seq
MIRT1346490	hsa-miR-609	CLIP-seq
MIRT2102555	hsa-miR-615-5p	CLIP-seq
MIRT1346491	hsa-miR-618	CLIP-seq
MIRT2102556	hsa-miR-642b	CLIP-seq
MIRT2102557	hsa-miR-645	CLIP-seq
MIRT1346434	hsa-miR-650	CLIP-seq
MIRT1346444	hsa-miR-655	CLIP-seq
MIRT2102558	hsa-miR-657	CLIP-seq
MIRT2102559	hsa-miR-873	CLIP-seq
MIRT2102560	hsa-miR-888	CLIP-seq
MIRT1346445	hsa-miR-9	CLIP-seq
MIRT1346493	hsa-miR-934	CLIP-seq
MIRT1346435	hsa-miR-940	CLIP-seq
MIRT1346401	hsa-miR-1229	CLIP-seq
MIRT1346446	hsa-miR-124	CLIP-seq
MIRT2327011	hsa-miR-1245b-5p	CLIP-seq
MIRT2102502	hsa-miR-203	CLIP-seq
MIRT2327012	hsa-miR-3142	CLIP-seq
MIRT2327013	hsa-miR-3616-3p	CLIP-seq
MIRT1346463	hsa-miR-3618	CLIP-seq
MIRT1346464	hsa-miR-365	CLIP-seq
MIRT2102519	hsa-miR-3689a-3p	CLIP-seq
MIRT2102520	hsa-miR-3689c	CLIP-seq
MIRT2327014	hsa-miR-3907	CLIP-seq
MIRT2102522	hsa-miR-3922-5p	CLIP-seq
MIRT2327015	hsa-miR-4267	CLIP-seq
MIRT1346421	hsa-miR-4436b-3p	CLIP-seq
MIRT2102532	hsa-miR-4457	CLIP-seq
MIRT2327016	hsa-miR-451b	CLIP-seq
MIRT2327017	hsa-miR-4650-5p	CLIP-seq
MIRT1346427	hsa-miR-4668-3p	CLIP-seq
MIRT2102542	hsa-miR-4728-5p	CLIP-seq
MIRT2102543	hsa-miR-4731-3p	CLIP-seq
MIRT1346477	hsa-miR-4749-3p	CLIP-seq
MIRT2102545	hsa-miR-4753-5p	CLIP-seq
MIRT2102547	hsa-miR-4801	CLIP-seq
MIRT1346482	hsa-miR-506	CLIP-seq
MIRT2102552	hsa-miR-545	CLIP-seq
MIRT1346484	hsa-miR-548an	CLIP-seq
MIRT1346487	hsa-miR-561	CLIP-seq
MIRT1346490	hsa-miR-609	CLIP-seq
MIRT2102556	hsa-miR-642b	CLIP-seq
MIRT1346448	hsa-miR-139-5p	CLIP-seq
MIRT1346454	hsa-miR-299-3p	CLIP-seq
MIRT1346456	hsa-miR-3151	CLIP-seq
MIRT2102522	hsa-miR-3922-5p	CLIP-seq
MIRT1346468	hsa-miR-4447	CLIP-seq
MIRT1346469	hsa-miR-4450	CLIP-seq
MIRT2102532	hsa-miR-4457	CLIP-seq
MIRT1346470	hsa-miR-4472	CLIP-seq
MIRT1346474	hsa-miR-4491	CLIP-seq
MIRT1346475	hsa-miR-4657	CLIP-seq
MIRT2102543	hsa-miR-4731-3p	CLIP-seq
MIRT2102545	hsa-miR-4753-5p	CLIP-seq
MIRT2102547	hsa-miR-4801	CLIP-seq
MIRT1346480	hsa-miR-491-5p	CLIP-seq
MIRT1346491	hsa-miR-618	CLIP-seq
MIRT2102498	hsa-miR-1207-3p	CLIP-seq
MIRT2440393	hsa-miR-1248	CLIP-seq
MIRT2102499	hsa-miR-1287	CLIP-seq
MIRT2102500	hsa-miR-140-3p	CLIP-seq
MIRT1346449	hsa-miR-150	CLIP-seq
MIRT2102501	hsa-miR-197	CLIP-seq
MIRT2102503	hsa-miR-2110	CLIP-seq
MIRT2102509	hsa-miR-3150a-3p	CLIP-seq
MIRT2440394	hsa-miR-3179	CLIP-seq
MIRT2102513	hsa-miR-3201	CLIP-seq
MIRT1346412	hsa-miR-3202	CLIP-seq
MIRT2102522	hsa-miR-3922-5p	CLIP-seq
MIRT2440395	hsa-miR-4271	CLIP-seq
MIRT2102525	hsa-miR-4281	CLIP-seq
MIRT2102530	hsa-miR-4436a	CLIP-seq
MIRT2102532	hsa-miR-4457	CLIP-seq
MIRT2440396	hsa-miR-4688	CLIP-seq
MIRT2102540	hsa-miR-4700-3p	CLIP-seq
MIRT2440397	hsa-miR-4711-5p	CLIP-seq
MIRT2440398	hsa-miR-4725-3p	CLIP-seq
MIRT2102543	hsa-miR-4731-3p	CLIP-seq
MIRT2102544	hsa-miR-4740-3p	CLIP-seq
MIRT2440399	hsa-miR-4747-5p	CLIP-seq
MIRT2102545	hsa-miR-4753-5p	CLIP-seq
MIRT2102546	hsa-miR-4791	CLIP-seq
MIRT2102547	hsa-miR-4801	CLIP-seq
MIRT2102551	hsa-miR-512-5p	CLIP-seq
MIRT2102554	hsa-miR-587	CLIP-seq
MIRT2440400	hsa-miR-635	CLIP-seq
MIRT2102556	hsa-miR-642b	CLIP-seq
MIRT2102522	hsa-miR-3922-5p	CLIP-seq
MIRT2102545	hsa-miR-4753-5p	CLIP-seq
MIRT2102498	hsa-miR-1207-3p	CLIP-seq
MIRT2440393	hsa-miR-1248	CLIP-seq
MIRT2622336	hsa-miR-125a-3p	CLIP-seq
MIRT2622337	hsa-miR-1271	CLIP-seq
MIRT2102499	hsa-miR-1287	CLIP-seq
MIRT2102500	hsa-miR-140-3p	CLIP-seq
MIRT1346449	hsa-miR-150	CLIP-seq
MIRT1346404	hsa-miR-1827	CLIP-seq
MIRT2102501	hsa-miR-197	CLIP-seq
MIRT1346494	hsa-miR-1976	CLIP-seq
MIRT1346437	hsa-miR-200b	CLIP-seq
MIRT1346438	hsa-miR-200c	CLIP-seq
MIRT2102503	hsa-miR-2110	CLIP-seq
MIRT2102505	hsa-miR-3120-3p	CLIP-seq
MIRT2102506	hsa-miR-3127-5p	CLIP-seq
MIRT2102507	hsa-miR-3135	CLIP-seq
MIRT2102509	hsa-miR-3150a-3p	CLIP-seq
MIRT2102510	hsa-miR-3162-5p	CLIP-seq
MIRT2102511	hsa-miR-3173-3p	CLIP-seq
MIRT2622338	hsa-miR-3175	CLIP-seq
MIRT2440394	hsa-miR-3179	CLIP-seq
MIRT2622339	hsa-miR-3181	CLIP-seq
MIRT2102512	hsa-miR-3184	CLIP-seq
MIRT2102513	hsa-miR-3201	CLIP-seq
MIRT1346412	hsa-miR-3202	CLIP-seq
MIRT1346439	hsa-miR-323-3p	CLIP-seq
MIRT2622340	hsa-miR-324-5p	CLIP-seq
MIRT2622341	hsa-miR-339-5p	CLIP-seq
MIRT1346440	hsa-miR-3664-5p	CLIP-seq
MIRT2622342	hsa-miR-3688-3p	CLIP-seq
MIRT1346441	hsa-miR-374c	CLIP-seq
MIRT2327014	hsa-miR-3907	CLIP-seq
MIRT2102522	hsa-miR-3922-5p	CLIP-seq
MIRT2622343	hsa-miR-3944-3p	CLIP-seq
MIRT1346416	hsa-miR-3978	CLIP-seq
MIRT1346443	hsa-miR-409-3p	CLIP-seq
MIRT2102524	hsa-miR-423-5p	CLIP-seq
MIRT1346496	hsa-miR-4252	CLIP-seq
MIRT2622344	hsa-miR-4260	CLIP-seq
MIRT1346467	hsa-miR-4261	CLIP-seq
MIRT2622345	hsa-miR-4264	CLIP-seq
MIRT2440395	hsa-miR-4271	CLIP-seq
MIRT2102525	hsa-miR-4281	CLIP-seq
MIRT2622346	hsa-miR-4287	CLIP-seq
MIRT2102530	hsa-miR-4436a	CLIP-seq
MIRT1346423	hsa-miR-4443	CLIP-seq
MIRT2102531	hsa-miR-4452	CLIP-seq
MIRT2102532	hsa-miR-4457	CLIP-seq
MIRT2622347	hsa-miR-4469	CLIP-seq
MIRT2327016	hsa-miR-451b	CLIP-seq
MIRT2622348	hsa-miR-4540	CLIP-seq
MIRT2622349	hsa-miR-4642	CLIP-seq
MIRT2622350	hsa-miR-4656	CLIP-seq
MIRT2622351	hsa-miR-4685-3p	CLIP-seq
MIRT2440396	hsa-miR-4688	CLIP-seq
MIRT2102539	hsa-miR-4695-5p	CLIP-seq
MIRT2102540	hsa-miR-4700-3p	CLIP-seq
MIRT2102541	hsa-miR-4710	CLIP-seq
MIRT2440397	hsa-miR-4711-5p	CLIP-seq
MIRT1346497	hsa-miR-4722-3p	CLIP-seq
MIRT2440398	hsa-miR-4725-3p	CLIP-seq
MIRT2622352	hsa-miR-4726-3p	CLIP-seq
MIRT2622353	hsa-miR-4727-5p	CLIP-seq
MIRT2102543	hsa-miR-4731-3p	CLIP-seq
MIRT2622354	hsa-miR-4733-5p	CLIP-seq
MIRT2102544	hsa-miR-4740-3p	CLIP-seq
MIRT2440399	hsa-miR-4747-5p	CLIP-seq
MIRT2622355	hsa-miR-4750	CLIP-seq
MIRT2102545	hsa-miR-4753-5p	CLIP-seq
MIRT1346432	hsa-miR-4786-3p	CLIP-seq
MIRT1346479	hsa-miR-4786-5p	CLIP-seq
MIRT2102546	hsa-miR-4791	CLIP-seq
MIRT2622356	hsa-miR-4797-3p	CLIP-seq
MIRT2102547	hsa-miR-4801	CLIP-seq
MIRT1346498	hsa-miR-483-3p	CLIP-seq
MIRT1346481	hsa-miR-494	CLIP-seq
MIRT2102551	hsa-miR-512-5p	CLIP-seq
MIRT2622357	hsa-miR-513a-3p	CLIP-seq
MIRT2102552	hsa-miR-545	CLIP-seq
MIRT2102553	hsa-miR-548p	CLIP-seq
MIRT2622358	hsa-miR-553	CLIP-seq
MIRT2622359	hsa-miR-554	CLIP-seq
MIRT2622360	hsa-miR-570	CLIP-seq
MIRT2102554	hsa-miR-587	CLIP-seq
MIRT2622361	hsa-miR-616	CLIP-seq
MIRT2622362	hsa-miR-617	CLIP-seq
MIRT2622363	hsa-miR-622	CLIP-seq
MIRT2440400	hsa-miR-635	CLIP-seq
MIRT2102556	hsa-miR-642b	CLIP-seq
MIRT1346444	hsa-miR-655	CLIP-seq
MIRT1346492	hsa-miR-769-5p	CLIP-seq
MIRT1346445	hsa-miR-9	CLIP-seq
MIRT2622364	hsa-miR-939	CLIP-seq
MIRT1346435	hsa-miR-940	CLIP-seq
MIRT2622365	hsa-miR-96	CLIP-seq
MIRT2102498	hsa-miR-1207-3p	CLIP-seq
MIRT2440393	hsa-miR-1248	CLIP-seq
MIRT2622336	hsa-miR-125a-3p	CLIP-seq
MIRT2622337	hsa-miR-1271	CLIP-seq
MIRT2102499	hsa-miR-1287	CLIP-seq
MIRT2102500	hsa-miR-140-3p	CLIP-seq
MIRT1346449	hsa-miR-150	CLIP-seq
MIRT2102501	hsa-miR-197	CLIP-seq
MIRT1346494	hsa-miR-1976	CLIP-seq
MIRT1346437	hsa-miR-200b	CLIP-seq
MIRT1346438	hsa-miR-200c	CLIP-seq
MIRT2102503	hsa-miR-2110	CLIP-seq
MIRT2102505	hsa-miR-3120-3p	CLIP-seq
MIRT2102509	hsa-miR-3150a-3p	CLIP-seq
MIRT2102510	hsa-miR-3162-5p	CLIP-seq
MIRT1346457	hsa-miR-3163	CLIP-seq
MIRT2102511	hsa-miR-3173-3p	CLIP-seq
MIRT2440394	hsa-miR-3179	CLIP-seq
MIRT2622339	hsa-miR-3181	CLIP-seq
MIRT2102512	hsa-miR-3184	CLIP-seq
MIRT2102513	hsa-miR-3201	CLIP-seq
MIRT1346412	hsa-miR-3202	CLIP-seq
MIRT1346439	hsa-miR-323-3p	CLIP-seq
MIRT2622340	hsa-miR-324-5p	CLIP-seq
MIRT2690697	hsa-miR-326	CLIP-seq
MIRT2690698	hsa-miR-330-5p	CLIP-seq
MIRT2622341	hsa-miR-339-5p	CLIP-seq
MIRT1346440	hsa-miR-3664-5p	CLIP-seq
MIRT2622342	hsa-miR-3688-3p	CLIP-seq
MIRT1346441	hsa-miR-374c	CLIP-seq
MIRT2327014	hsa-miR-3907	CLIP-seq
MIRT2102522	hsa-miR-3922-5p	CLIP-seq
MIRT2690699	hsa-miR-3926	CLIP-seq
MIRT2622343	hsa-miR-3944-3p	CLIP-seq
MIRT1346416	hsa-miR-3978	CLIP-seq
MIRT1346443	hsa-miR-409-3p	CLIP-seq
MIRT2102524	hsa-miR-423-5p	CLIP-seq
MIRT1346496	hsa-miR-4252	CLIP-seq
MIRT1346467	hsa-miR-4261	CLIP-seq
MIRT2622345	hsa-miR-4264	CLIP-seq
MIRT2440395	hsa-miR-4271	CLIP-seq
MIRT2102525	hsa-miR-4281	CLIP-seq
MIRT2622346	hsa-miR-4287	CLIP-seq
MIRT2102530	hsa-miR-4436a	CLIP-seq
MIRT2102532	hsa-miR-4457	CLIP-seq
MIRT2622347	hsa-miR-4469	CLIP-seq
MIRT2690700	hsa-miR-4490	CLIP-seq
MIRT2327016	hsa-miR-451b	CLIP-seq
MIRT2622348	hsa-miR-4540	CLIP-seq
MIRT2622349	hsa-miR-4642	CLIP-seq
MIRT2622350	hsa-miR-4656	CLIP-seq
MIRT2622351	hsa-miR-4685-3p	CLIP-seq
MIRT2440396	hsa-miR-4688	CLIP-seq
MIRT2102539	hsa-miR-4695-5p	CLIP-seq
MIRT2102540	hsa-miR-4700-3p	CLIP-seq
MIRT2102541	hsa-miR-4710	CLIP-seq
MIRT2440397	hsa-miR-4711-5p	CLIP-seq
MIRT1346497	hsa-miR-4722-3p	CLIP-seq
MIRT2440398	hsa-miR-4725-3p	CLIP-seq
MIRT2622352	hsa-miR-4726-3p	CLIP-seq
MIRT2622353	hsa-miR-4727-5p	CLIP-seq
MIRT2102543	hsa-miR-4731-3p	CLIP-seq
MIRT2622354	hsa-miR-4733-5p	CLIP-seq
MIRT2102544	hsa-miR-4740-3p	CLIP-seq
MIRT2440399	hsa-miR-4747-5p	CLIP-seq
MIRT2622355	hsa-miR-4750	CLIP-seq
MIRT2102545	hsa-miR-4753-5p	CLIP-seq
MIRT2690701	hsa-miR-4774-5p	CLIP-seq
MIRT1346432	hsa-miR-4786-3p	CLIP-seq
MIRT1346479	hsa-miR-4786-5p	CLIP-seq
MIRT2102546	hsa-miR-4791	CLIP-seq
MIRT2622356	hsa-miR-4797-3p	CLIP-seq
MIRT2102547	hsa-miR-4801	CLIP-seq
MIRT1346498	hsa-miR-483-3p	CLIP-seq
MIRT1346481	hsa-miR-494	CLIP-seq
MIRT2102551	hsa-miR-512-5p	CLIP-seq
MIRT2622357	hsa-miR-513a-3p	CLIP-seq
MIRT2102552	hsa-miR-545	CLIP-seq
MIRT2102553	hsa-miR-548p	CLIP-seq
MIRT2622358	hsa-miR-553	CLIP-seq
MIRT2622359	hsa-miR-554	CLIP-seq
MIRT2622360	hsa-miR-570	CLIP-seq
MIRT2690702	hsa-miR-583	CLIP-seq
MIRT2102554	hsa-miR-587	CLIP-seq
MIRT2690703	hsa-miR-593	CLIP-seq
MIRT2622361	hsa-miR-616	CLIP-seq
MIRT2622362	hsa-miR-617	CLIP-seq
MIRT2622363	hsa-miR-622	CLIP-seq
MIRT2440400	hsa-miR-635	CLIP-seq
MIRT2102556	hsa-miR-642b	CLIP-seq
MIRT1346444	hsa-miR-655	CLIP-seq
MIRT1346492	hsa-miR-769-5p	CLIP-seq
MIRT1346445	hsa-miR-9	CLIP-seq
MIRT2622365	hsa-miR-96	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SIRT1	Unknown	21778425

Gene ontology (GO) Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IEA
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	TAS	1623525, 14676841
GO:0005154	Function	Epidermal growth factor receptor binding	ISS
GO:0005158	Function	Insulin receptor binding	IPI	7537849
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	7541045
GO:0005168	Function	Neurotrophin TRKA receptor binding	IPI	15488758
GO:0005515	Function	Protein binding	IPI	7518560, 7535773, 7541045, 7542744, 7559478, 8034616, 8491186, 8663178, 8939605, 8940013, 8995379, 9175774, 9254595, 9544989, 9593725, 10356320, 11694516, 11827484, 11877420, 12213123, 12577067, 15629149, 15657067, 16189514, 16273093, 16520382, 16843263, 19172738, 19380743, 20010870
GO:0005543	Function	Phospholipid binding	TAS	14676841
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14676841
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	TAS	1623525
GO:0007507	Process	Heart development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1623525
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0016525	Process	Negative regulation of angiogenesis	IGI	24177325
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042742	Process	Defense response to bacterium	IMP	20624904
GO:0043066	Process	Negative regulation of apoptotic process	IMP	20624904
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	14676841
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	20624904
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20624904
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20624904
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	12925710
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0048408	Function	Epidermal growth factor binding	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	20624904
GO:0070435	Component	Shc-EGFR complex	ISS
GO:0071363	Process	Cellular response to growth factor stimulus	IDA	20010870
GO:0071864	Process	Positive regulation of cell proliferation in bone marrow	IGI	24177325
GO:0090322	Process	Regulation of superoxide metabolic process	IGI	24177325
GO:0098609	Process	Cell-cell adhesion	IEA

Other IDs

• MIM: 600560
• HGNC: 10840
• e!Ensembl: ENSG00000160691

Protein

• UniProt ID: P29353
• Protein name: SHC-transforming protein 1 (SHC-transforming protein 3) (SHC-transforming protein A) (Src homology 2 domain-containing-transforming protein C1) (SH2 domain protein C1)
• Protein function: Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Isoform p46Shc and isoform p52Shc, once phosphorylated, couple activated recept
• PDB: 1MIL , 1N3H , 1OY2 , 1QG1 , 1SHC , 1TCE , 2L1C , 4JMH , 4XWX , 5CZI , 6DM4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	488 → 559	SH2 domain	Domain
  PF00640	PID	162 → 318	Phosphotyrosine interaction domain (PTB/PID)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in neural stem cells but absent in mature neurons.
• Sequence:

  MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
  FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
  RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
  FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
  LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
  ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
  GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
  LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
  EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
  VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL

• Sequence length: 583

Pathways

KEGG Pathway	Reactome Pathway
EGFR tyrosine kinase inhibitor resistance	Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
Endocrine resistance	SHC1 events in ERBB2 signaling
ErbB signaling pathway	SHC1 events in ERBB4 signaling
Ras signaling pathway	Signalling to RAS
Chemokine signaling pathway	SHC1 events in EGFR signaling
Phospholipase D signaling pathway	Tie2 Signaling
Focal adhesion	DAP12 signaling
Natural killer cell mediated cytotoxicity	SHC-related events triggered by IGF1R
Neurotrophin signaling pathway	Role of LAT2/NTAL/LAB on calcium mobilization
Insulin signaling pathway	FCERI mediated MAPK activation
Estrogen signaling pathway	FCERI mediated Ca+2 mobilization
Prolactin signaling pathway	Integrin signaling
Relaxin signaling pathway	XBP1(S) activates chaperone genes
Growth hormone synthesis, secretion and action	Interleukin-3, Interleukin-5 and GM-CSF signaling
Alcoholism	Constitutive Signaling by EGFRvIII
Bacterial invasion of epithelial cells	SHC-mediated cascade:FGFR1
MicroRNAs in cancer	SHC-mediated cascade:FGFR2
Glioma	SHC-mediated cascade:FGFR3
Chronic myeloid leukemia	SHC-mediated cascade:FGFR4
Breast cancer	RAF/MAP kinase cascade
Hepatocellular carcinoma	Signal attenuation
Gastric cancer	Insulin receptor signalling cascade
	MET activates RAS signaling
	RET signaling
	Interleukin-15 signaling
	Extra-nuclear estrogen signaling
	Interleukin-2 signaling
	Erythropoietin activates RAS
	Interleukin receptor SHC signaling
	Constitutive Signaling by Overexpressed ERBB2
	Signaling by ERBB2 KD Mutants
	Signaling by ERBB2 ECD mutants
	Signaling by ERBB2 TMD/JMD mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (7)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	11796754	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	19168439	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	27569725, 37156999, 37523193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	27569725, 37156999, 37523193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	32659284	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	27569725, 37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (84)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	22788679, 37406134	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20842738		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	16519809	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20842738		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20842738	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	26774166		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	39391879	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	22740707	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15308584, 17158237, 18611262, 28276425, 29540831, 31202267		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16288304, 18611262, 21704603, 26976638, 29453318, 31759986	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39527598	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29453318	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23211466		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32191631	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18391978		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25791160	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26198048, 35935986, 39209911	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34117717	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	16519809	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18162611		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	27789276		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25904764		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	16519809, 24349153	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26464652		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17908971		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30731403		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26464652, 29693170	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31605605		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16519809, 20842738		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16519809, 20842738	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21536720		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15562031, 19590843		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15562031, 19590843		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33029194	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22740707	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21536720		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27832579		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	19055724		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19055724	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	34646884	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10541432, 15870690		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36980184	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10541432, 15870690		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28831120	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29453318	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20842738, 27832579		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27569725		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	27569725		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25904764		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	18067454		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20697350	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12586295		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29330146, 31398350, 31788087		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24189400, 34117717, 37965333	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34646884	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15308584, 17158237, 18611262, 28276425, 29540831, 31202267		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18391978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24216611, 25791160, 27605668		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16170380		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30592290		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26043699		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26464652		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15308584		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28276425		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17409413		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28392480, 7675449		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29057481		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30177836		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18611262	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23374718, 26122877		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25815782	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24395385	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24216611, 25791160, 27605668		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25791160, 27605668	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16170380		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14990987, 16170380, 18504439		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34646884	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17596878		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30592290		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38537385	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24349153	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

JUND 2 shared diseasesMotor neuron disease, Liver cirrhosis 5 shared evidence sourcesDisgenet (Amyotrophic lateral sclerosis), CTD (Amyotrophic lateral sclerosis), Disgenet (Motor neuron disease), CTD (Liver cirrhosis), Disgenet (Liver cirrhosis) Related via 2 shared diseases including Motor neuron disease, Liver cirrhosis — evidence mostly Disgenet. BAMBI 2 shared diseasesCardiomegaly, Liver cirrhosis 3 shared evidence sourcesCTD (Cardiomegaly), CTD (Liver cirrhosis), Disgenet (Liver cirrhosis) Related via 2 shared diseases including Cardiomegaly, Liver cirrhosis — evidence mostly CTD. FGF6 1 shared diseaseMotor neuron disease 7 shared pathwaysRas signaling pathway, Breast cancer, Gastric cancer, RAF/MAP kinase cascade, SHC-mediated cascade:FGFR4, SHC-mediated cascade:FGFR1, SHC-mediated cascade:FGFR2 3 shared evidence sourcesDisgenet (Amyotrophic lateral sclerosis), CTD (Amyotrophic lateral sclerosis), Disgenet (Motor neuron disease) Related via 7 shared pathways including Ras signaling pathway, Breast cancer — evidence mostly Disgenet. FMO1 1 shared diseaseMotor neuron disease 3 shared evidence sourcesDisgenet (Amyotrophic lateral sclerosis), CTD (Amyotrophic lateral sclerosis), Disgenet (Motor neuron disease) Related via 1 shared disease including Motor neuron disease — evidence mostly Disgenet. GBX2 1 shared diseaseMotor neuron disease 3 shared evidence sourcesDisgenet (Amyotrophic lateral sclerosis), CTD (Amyotrophic lateral sclerosis), Disgenet (Motor neuron disease) Related via 1 shared disease including Motor neuron disease — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
JUND	2	["Motor neuron disease","Liver cirrhosis"]	0	[]	5	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)","Disgenet (Motor neuron disease)","CTD (Liver cirrhosis)","Disgenet (Liver cirrhosis)"]
BAMBI	2	["Cardiomegaly","Liver cirrhosis"]	0	[]	3	["CTD (Cardiomegaly)","CTD (Liver cirrhosis)","Disgenet (Liver cirrhosis)"]
FGF6	1	["Motor neuron disease"]	7	["Ras signaling pathway","Breast cancer","Gastric cancer","RAF\/MAP kinase cascade","SHC-mediated cascade:FGFR4","SHC-mediated cascade:FGFR1","SHC-mediated cascade:FGFR2"]	3	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)","Disgenet (Motor neuron disease)"]
FMO1	1	["Motor neuron disease"]	0	[]	3	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)","Disgenet (Motor neuron disease)"]
GBX2	1	["Motor neuron disease"]	0	[]	3	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)","Disgenet (Motor neuron disease)"]

Diseases Linked via Similar Genes

Glomerulonephritis Linked via 1 of 5 related genesJUND Lung neoplasms Linked via 1 of 5 related genesJUND Status epilepticus Linked via 1 of 5 related genesJUND Systemic lupus erythematosus Linked via 1 of 5 related genesJUND Cataract Linked via 1 of 5 related genesBAMBI

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Glomerulonephritis	1	["JUND"]
Lung neoplasms	1	["JUND"]
Status epilepticus	1	["JUND"]
Systemic lupus erythematosus	1	["JUND"]
Cataract	1	["BAMBI"]