SHANK2-AS3 (SHANK2 antisense RNA 3)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 220070 |
| Gene name | SHANK2 antisense RNA 3 |
| Gene symbol | SHANK2-AS3 |
| Synonyms (NCBI Gene) |
C11orf76
|
| Chromosome | 11 |
| Chromosome location | 11q13.4 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9BTD1 |
| Protein name | Putative uncharacterized protein SHANK2-AS3 |
| Family and domains | |
| Sequence |
MAQLPSAQMPAPRTQPDLILVHPVLALSGRAPSILCSVPWDACELLATAMWWKTRILWGV |
| Sequence length | 123 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with SHANK2-AS3 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to SHANK2-AS3 (see Related Genes above), that are NOT already directly curated for SHANK2-AS3 itself -- a lead worth checking, not a confirmed association.
0
|
|