SH3BP1 (SH3 domain binding protein 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23616
• Gene name: SH3 domain binding protein 1
• Gene symbol: SH3BP1
• Synonyms (NCBI Gene): ARHGAP43
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: This gene encodes a member of the Rho GTPase activating protein (RhoGAP) family. The encoded protein regulates Rac signaling and plays a role in cytoskeletal dynamics, cell motility and epithelial junction formation. This protein`s association with the ex

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017165	hsa-miR-335-5p	Microarray	18185580
MIRT029059	hsa-miR-26b-5p	Microarray	19088304
MIRT439642	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439642	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1344494	hsa-miR-1200	CLIP-seq
MIRT1344495	hsa-miR-1225-3p	CLIP-seq
MIRT1344496	hsa-miR-1233	CLIP-seq
MIRT1344497	hsa-miR-1253	CLIP-seq
MIRT1344498	hsa-miR-1343	CLIP-seq
MIRT1344499	hsa-miR-1910	CLIP-seq
MIRT1344500	hsa-miR-219-5p	CLIP-seq
MIRT1344501	hsa-miR-2355-3p	CLIP-seq
MIRT1344502	hsa-miR-28-5p	CLIP-seq
MIRT1344503	hsa-miR-31	CLIP-seq
MIRT1344504	hsa-miR-3121-3p	CLIP-seq
MIRT1344505	hsa-miR-3125	CLIP-seq
MIRT1344506	hsa-miR-3139	CLIP-seq
MIRT1344507	hsa-miR-3192	CLIP-seq
MIRT1344508	hsa-miR-3689a-3p	CLIP-seq
MIRT1344509	hsa-miR-3689c	CLIP-seq
MIRT1344510	hsa-miR-3916	CLIP-seq
MIRT1344511	hsa-miR-4324	CLIP-seq
MIRT1344512	hsa-miR-4470	CLIP-seq
MIRT1344513	hsa-miR-455-3p	CLIP-seq
MIRT1344514	hsa-miR-4640-5p	CLIP-seq
MIRT1344515	hsa-miR-4690-5p	CLIP-seq
MIRT1344516	hsa-miR-4726-5p	CLIP-seq
MIRT1344517	hsa-miR-4742-5p	CLIP-seq
MIRT1344518	hsa-miR-4782-3p	CLIP-seq
MIRT1344519	hsa-miR-544b	CLIP-seq
MIRT1344520	hsa-miR-676	CLIP-seq
MIRT1344521	hsa-miR-708	CLIP-seq
MIRT1344522	hsa-miR-877	CLIP-seq
MIRT1344523	hsa-miR-939	CLIP-seq

Gene ontology (GO) Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000145	Component	Exocyst	IDA	21658605
GO:0001891	Component	Phagocytic cup	IDA	26465210
GO:0001891	Component	Phagocytic cup	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	IMP	22891260, 24841563
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	21044950, 21658605, 22891260, 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	22891260
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	22891260
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005912	Component	Adherens junction	IDA	22891260
GO:0005912	Component	Adherens junction	IEA
GO:0005923	Component	Bicellular tight junction	IDA	22891260
GO:0005923	Component	Bicellular tight junction	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006911	Process	Phagocytosis, engulfment	IMP	26465210
GO:0007015	Process	Actin filament organization	IMP	22891260, 26465210
GO:0007165	Process	Signal transduction	IEA
GO:0016477	Process	Cell migration	IMP	21658605
GO:0017124	Function	SH3 domain binding	IEA
GO:0030027	Component	Lamellipodium	IDA	24841563
GO:0030215	Function	Semaphorin receptor binding	IPI	24841563
GO:0030834	Process	Regulation of actin filament depolymerization	IMP	24841563
GO:0031252	Component	Cell leading edge	IDA	21658605
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	24841563
GO:0034329	Process	Cell junction assembly	IMP	22891260
GO:0035020	Process	Regulation of Rac protein signal transduction	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043535	Process	Regulation of blood vessel endothelial cell migration	IMP	24841563
GO:0043547	Process	Positive regulation of GTPase activity	IMP	22891260, 24841563
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IMP	22891260
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IBA
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IEA
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IMP	22891260, 24841563, 26465210
GO:0070161	Component	Anchoring junction	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IMP	24841563
GO:0097178	Process	Ruffle assembly	IEA

Other IDs

• MIM: 617368
• HGNC: 10824
• e!Ensembl: ENSG00000100092

Protein

• UniProt ID: Q9Y3L3
• Protein name: SH3 domain-binding protein 1
• Protein function: GTPase activating protein (GAP) which specifically converts GTP-bound Rho-type GTPases including RAC1 and CDC42 in their inactive GDP-bound form. By specifically inactivating RAC1 at the leading edge of migrating cells, it regulates the spatiote
• PDB: 4J9D , 4J9F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00620	RhoGAP	290 → 441	RhoGAP domain	Domain
  PF03114	BAR	2 → 254	BAR domain	Domain

• Sequence:

  MMKRQLHRMRQLAQTGSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNIHKRLQACLQGQ
  SGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLE
  RDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGSPGSHS
  HTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIRLLEIQADYHRR
  SLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMML
  LSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLM
  TFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTP
  SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGL
  FSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAATKERTESEVPP
  RPASPKVTRSPPETAAPVEDMARRTKRPAPARPTMPPPQVSGSRSSPPAPPLPPGSGSPG
  TPQALPRRLVGSSLRAPTVPPPLPPTPPQPARRQSRRSPASPSPASPGPASPSPVSLSNP
  AQVDLGAATAEGGAPEAISGVPTPPAIPPQPRPRSLASETN

• Sequence length: 701

Related Genes

No strongly related genes found yet for SH3BP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SH3BP1.