SFTA3 (surfactant associated 3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 253970
Gene name Surfactant associated 3
Gene symbol SFTA3
Synonyms (NCBI Gene)
NANCIPAHRFSFTPHSP-HSPH
Chromosome 14
Chromosome location 14q13.3
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1342114 hsa-miR-3163 CLIP-seq
MIRT1342115 hsa-miR-4282 CLIP-seq
MIRT1342116 hsa-miR-590-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IDA 24743970, 29955092
GO:0005737 Component Cytoplasm IDA 24743970
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
617860 18387 ENSG00000257520
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C7M3
Protein name Surfactant-associated protein 3 (Surfactant-associated protein H) (SP-H)
Protein function Putative surfactant protein. May be involved in wound healing and in the reduction of the surface tension at the ocular surface.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Found in lung alveolar cells type I and II, as well as alveolar macrophages (at protein level). Detected also in testis and kidney. Expressed by different tissues of the ocular system like cornea, conjuctiva, lacrimal gland, eyelid and
Sequence 
MRAGFSDFQLIRDQVLFLQDQAQRLTEWLQLSGFENPVSESTTLCLREREKRIPTCVAVC
VPSPGTVHTALLHPTTLSQSRSSSEAKMLIIHTA
Sequence length 94
Interactions View interactions

No strongly related genes found yet for SFTA3.

No additional diseases found yet through genes similar to SFTA3.