SETD6 (SET domain containing 6, protein lysine methyltransferase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79918
• Gene name: SET domain containing 6, protein lysine methyltransferase
• Gene symbol: SETD6
• Synonyms (NCBI Gene): -
• Chromosome: 16
• Chromosome location: 16q21
• Summary: This gene encodes a methyltransferase that adds a methyl group to the histone H2AZ, which is involved in nuclear receptor-dependent transcription. The protein also interacts with several endogenous proteins which are involved in nuclear hormone receptor s

miRNA Show/Hide all (150)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042072	hsa-miR-484	CLASH	23622248
MIRT563253	hsa-miR-3662	PAR-CLIP	20371350
MIRT563252	hsa-miR-3133	PAR-CLIP	20371350
MIRT563251	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT563250	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT563249	hsa-miR-4678	PAR-CLIP	20371350
MIRT343722	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT563253	hsa-miR-3662	PAR-CLIP	20371350
MIRT563252	hsa-miR-3133	PAR-CLIP	20371350
MIRT563251	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT563250	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT563249	hsa-miR-4678	PAR-CLIP	20371350
MIRT343722	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT1340367	hsa-miR-1225-5p	CLIP-seq
MIRT1340368	hsa-miR-1273d	CLIP-seq
MIRT1340369	hsa-miR-1305	CLIP-seq
MIRT1340370	hsa-miR-133a	CLIP-seq
MIRT1340371	hsa-miR-133b	CLIP-seq
MIRT1340372	hsa-miR-1911	CLIP-seq
MIRT1340373	hsa-miR-21	CLIP-seq
MIRT1340374	hsa-miR-296-3p	CLIP-seq
MIRT1340375	hsa-miR-2964a-5p	CLIP-seq
MIRT1340376	hsa-miR-3152-5p	CLIP-seq
MIRT1340377	hsa-miR-339-5p	CLIP-seq
MIRT1340378	hsa-miR-3613-5p	CLIP-seq
MIRT1340379	hsa-miR-3935	CLIP-seq
MIRT1340380	hsa-miR-3941	CLIP-seq
MIRT1340381	hsa-miR-4281	CLIP-seq
MIRT1340382	hsa-miR-4282	CLIP-seq
MIRT1340383	hsa-miR-433	CLIP-seq
MIRT1340384	hsa-miR-4477a	CLIP-seq
MIRT1340385	hsa-miR-4658	CLIP-seq
MIRT1340386	hsa-miR-466	CLIP-seq
MIRT1340387	hsa-miR-4672	CLIP-seq
MIRT1340388	hsa-miR-4724-3p	CLIP-seq
MIRT1340389	hsa-miR-4758-5p	CLIP-seq
MIRT1340390	hsa-miR-4765	CLIP-seq
MIRT1340391	hsa-miR-4774-3p	CLIP-seq
MIRT1340392	hsa-miR-520a-5p	CLIP-seq
MIRT1340393	hsa-miR-525-5p	CLIP-seq
MIRT1340394	hsa-miR-548ac	CLIP-seq
MIRT1340395	hsa-miR-548ae	CLIP-seq
MIRT1340396	hsa-miR-548aj	CLIP-seq
MIRT1340397	hsa-miR-548am	CLIP-seq
MIRT1340398	hsa-miR-548d-3p	CLIP-seq
MIRT1340399	hsa-miR-548m	CLIP-seq
MIRT1340400	hsa-miR-548x	CLIP-seq
MIRT1340401	hsa-miR-548z	CLIP-seq
MIRT1340402	hsa-miR-555	CLIP-seq
MIRT1340403	hsa-miR-590-5p	CLIP-seq
MIRT1340404	hsa-miR-605	CLIP-seq
MIRT1340405	hsa-miR-629	CLIP-seq
MIRT1340406	hsa-miR-924	CLIP-seq
MIRT1340407	hsa-miR-935	CLIP-seq
MIRT1340408	hsa-miR-1238	CLIP-seq
MIRT1340409	hsa-miR-142-5p	CLIP-seq
MIRT1340410	hsa-miR-340	CLIP-seq
MIRT1340411	hsa-miR-410	CLIP-seq
MIRT1340369	hsa-miR-1305	CLIP-seq
MIRT2100576	hsa-miR-3164	CLIP-seq
MIRT2100577	hsa-miR-3202	CLIP-seq
MIRT2100578	hsa-miR-4682	CLIP-seq
MIRT2100579	hsa-miR-4747-5p	CLIP-seq
MIRT1340399	hsa-miR-548m	CLIP-seq
MIRT2100580	hsa-miR-617	CLIP-seq
MIRT2100581	hsa-miR-873	CLIP-seq
MIRT2325268	hsa-miR-125a-5p	CLIP-seq
MIRT2325269	hsa-miR-125b	CLIP-seq
MIRT2325270	hsa-miR-137	CLIP-seq
MIRT1340409	hsa-miR-142-5p	CLIP-seq
MIRT2325271	hsa-miR-205	CLIP-seq
MIRT2325272	hsa-miR-2113	CLIP-seq
MIRT2325273	hsa-miR-2116	CLIP-seq
MIRT2325274	hsa-miR-3127-5p	CLIP-seq
MIRT2325275	hsa-miR-3938	CLIP-seq
MIRT2325276	hsa-miR-4270	CLIP-seq
MIRT2325277	hsa-miR-4319	CLIP-seq
MIRT2325278	hsa-miR-4324	CLIP-seq
MIRT2325279	hsa-miR-4326	CLIP-seq
MIRT2325280	hsa-miR-4441	CLIP-seq
MIRT2325281	hsa-miR-4732-3p	CLIP-seq
MIRT2325282	hsa-miR-670	CLIP-seq
MIRT2325283	hsa-miR-876-3p	CLIP-seq
MIRT2459158	hsa-miR-2117	CLIP-seq
MIRT2459159	hsa-miR-216a	CLIP-seq
MIRT2459160	hsa-miR-3187-3p	CLIP-seq
MIRT2459161	hsa-miR-361-3p	CLIP-seq
MIRT2459162	hsa-miR-4273	CLIP-seq
MIRT2459163	hsa-miR-4286	CLIP-seq
MIRT2459164	hsa-miR-4496	CLIP-seq
MIRT2459165	hsa-miR-4529-5p	CLIP-seq
MIRT2459166	hsa-miR-4677-5p	CLIP-seq
MIRT2459167	hsa-miR-4713-5p	CLIP-seq
MIRT2459168	hsa-miR-4738-3p	CLIP-seq
MIRT2459169	hsa-miR-4762-5p	CLIP-seq
MIRT2459170	hsa-miR-4790-3p	CLIP-seq
MIRT1340394	hsa-miR-548ac	CLIP-seq
MIRT1340395	hsa-miR-548ae	CLIP-seq
MIRT1340396	hsa-miR-548aj	CLIP-seq
MIRT1340397	hsa-miR-548am	CLIP-seq
MIRT1340398	hsa-miR-548d-3p	CLIP-seq
MIRT1340400	hsa-miR-548x	CLIP-seq
MIRT1340401	hsa-miR-548z	CLIP-seq
MIRT2459171	hsa-miR-885-5p	CLIP-seq
MIRT2459158	hsa-miR-2117	CLIP-seq
MIRT2459159	hsa-miR-216a	CLIP-seq
MIRT2459160	hsa-miR-3187-3p	CLIP-seq
MIRT2621002	hsa-miR-320e	CLIP-seq
MIRT2459161	hsa-miR-361-3p	CLIP-seq
MIRT2459162	hsa-miR-4273	CLIP-seq
MIRT2459163	hsa-miR-4286	CLIP-seq
MIRT2621003	hsa-miR-4427	CLIP-seq
MIRT2621004	hsa-miR-4438	CLIP-seq
MIRT2459164	hsa-miR-4496	CLIP-seq
MIRT2459165	hsa-miR-4529-5p	CLIP-seq
MIRT2459166	hsa-miR-4677-5p	CLIP-seq
MIRT2459167	hsa-miR-4713-5p	CLIP-seq
MIRT2459168	hsa-miR-4738-3p	CLIP-seq
MIRT2459169	hsa-miR-4762-5p	CLIP-seq
MIRT2459170	hsa-miR-4790-3p	CLIP-seq
MIRT2621005	hsa-miR-5095	CLIP-seq
MIRT1340394	hsa-miR-548ac	CLIP-seq
MIRT1340395	hsa-miR-548ae	CLIP-seq
MIRT1340396	hsa-miR-548aj	CLIP-seq
MIRT1340397	hsa-miR-548am	CLIP-seq
MIRT1340398	hsa-miR-548d-3p	CLIP-seq
MIRT1340400	hsa-miR-548x	CLIP-seq
MIRT1340401	hsa-miR-548z	CLIP-seq
MIRT2459171	hsa-miR-885-5p	CLIP-seq
MIRT2459158	hsa-miR-2117	CLIP-seq
MIRT2459159	hsa-miR-216a	CLIP-seq
MIRT2459160	hsa-miR-3187-3p	CLIP-seq
MIRT2459161	hsa-miR-361-3p	CLIP-seq
MIRT2459162	hsa-miR-4273	CLIP-seq
MIRT2459163	hsa-miR-4286	CLIP-seq
MIRT2459164	hsa-miR-4496	CLIP-seq
MIRT2459165	hsa-miR-4529-5p	CLIP-seq
MIRT2459166	hsa-miR-4677-5p	CLIP-seq
MIRT2459167	hsa-miR-4713-5p	CLIP-seq
MIRT2459168	hsa-miR-4738-3p	CLIP-seq
MIRT2459169	hsa-miR-4762-5p	CLIP-seq
MIRT2459170	hsa-miR-4790-3p	CLIP-seq
MIRT1340394	hsa-miR-548ac	CLIP-seq
MIRT1340395	hsa-miR-548ae	CLIP-seq
MIRT1340396	hsa-miR-548aj	CLIP-seq
MIRT1340397	hsa-miR-548am	CLIP-seq
MIRT1340398	hsa-miR-548d-3p	CLIP-seq
MIRT1340400	hsa-miR-548x	CLIP-seq
MIRT1340401	hsa-miR-548z	CLIP-seq
MIRT2459171	hsa-miR-885-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21131967
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21131967
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IBA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IDA	21131967, 21515635, 23324626, 30189201
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IEA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0018026	Process	Peptidyl-lysine monomethylation	IDA	21131967, 21515635, 30189201
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	21131967
GO:0032259	Process	Methylation	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0048863	Process	Stem cell differentiation	ISS
GO:0050727	Process	Regulation of inflammatory response	IMP	21131967
GO:0051059	Function	NF-kappaB binding	IPI	21131967
GO:1904047	Function	S-adenosyl-L-methionine binding	IDA	21515635

Other IDs

• MIM: 616424
• HGNC: 26116
• e!Ensembl: ENSG00000103037

Protein

• UniProt ID: Q8TBK2
• Protein name: N-lysine methyltransferase SETD6 (EC 2.1.1.-) (SET domain-containing protein 6)
• Protein function: Protein-lysine N-methyltransferase. Monomethylates 'Lys-310' of the RELA subunit of NF-kappa-B complex, leading to down-regulation of NF-kappa-B transcription factor activity (PubMed:21131967, PubMed:21515635, PubMed:30189201). Monomethylates 'L
• PDB: 3QXY , 3RC0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00856	SET	74 → 286	SET domain	Family
  PF09273	Rubis-subs-bind	331 → 465	Rubisco LSMT substrate-binding	Domain

• Sequence:

  MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSP
  PAQVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQS
  GWVPLLLALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKD
  LANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNS
  PVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFV
  EPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREE
  VLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSV
  LLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS

• Sequence length: 473

Pathways

Reactome Pathway:

PKMTs methylate histone lysines

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISM SPECTRUM DISORDER	—	GWAS catalog	33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28122346		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24751716, 30226578		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24751716	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28122346		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36938730	Associate	★☆☆☆☆ Found in Text Mining only
Familial Colorectal Cancer Type X	Colorectal Cancer	BEFREE	28973356		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35694846	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36604642	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30226578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28122346		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28973356		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30616239	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31081088	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28122346	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for SETD6.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SETD6.