SERTM2 (serine rich and transmembrane domain containing 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401613
Gene name Serine rich and transmembrane domain containing 2
Gene symbol SERTM2
Synonyms (NCBI Gene)
CARDELDKFZp686D0853LINC00890
Chromosome X
Chromosome location Xq23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
GO:0043231 Component Intracellular membrane-bounded organelle IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GWG4
Protein name Serine-rich and transmembrane domain-containing 2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15872 SRTM1 6 → 87 Serine-rich and transmembrane domain-containing protein 1 Family
Sequence 
MMEAHFKYHGNLTGRAHFPTLATEVDTSSDKYSNLYMYVGLFLSLLAILLILLFTMLLRL
KHVISPINSDSTESVPQFTDVEMQSRIPTP
Sequence length 90
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
ROTATOR CUFF TEAR — GWAS catalog 33482370
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Fibroid Tumor Leiomyoma BEFREE 28587571
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 28587571
★★★★★
★☆☆☆☆
Found in Text Mining only
Uterine Fibroids Uterine Fibroids BEFREE 28587571
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for SERTM2.

No additional diseases found yet through genes similar to SERTM2.