SERTAD4-AS1 (SERTAD4 antisense RNA 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 574036
Gene name SERTAD4 antisense RNA 1
Gene symbol SERTAD4-AS1
Synonyms (NCBI Gene)
C1orf133
Chromosome 1
Chromosome location 1q32.2
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 32019 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5TG53
Protein name Putative uncharacterized protein SERTAD4-AS1 (SERTAD4 antisense RNA 1) (SERTAD4 antisense gene protein 1)
Family and domains
Sequence 
MSARPSLPPLPAKPAGSPRLRERPAPVGPGGEDAYSLLLRPQLGTRKVARAEEAGGEEGK
REAEAWTRRAAASARRGGELRTEEPPPPAARLCCLGGGCGGGGGGGQKVSATASIPFSCK
RALLTSTIPLSPPAKRRGIRTWGHPSYLTPSPTMRD
Sequence length 156
Interactions View interactions

No strongly related genes found yet for SERTAD4-AS1.

No additional diseases found yet through genes similar to SERTAD4-AS1.