Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	89777
Gene name	Serpin family B member 12
Gene symbol	SERPINB12
Synonyms (NCBI Gene)	YUKOPIN
Chromosome	18
Chromosome location	18q21.33

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IMP	11604408
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	11604408
GO:0005886	Component	Plasma membrane	TAS
GO:0019899	Function	Enzyme binding	NAS	11604408
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0042177	Process	Negative regulation of protein catabolic process	NAS	11604408
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

MIM	HGNC	e!Ensembl
615662	14220	ENSG00000166634

Q96P63

Protein name

Serpin B12

Protein function

Inhibits trypsin and plasmin, but not thrombin, coagulation factor Xa, or urokinase-type plasminogen activator (PubMed:11604408). May play a role in cell differentiation (PubMed:30045019). {ECO:0000269|PubMed:11604408, ECO:0000269|PubMed:3004501

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	6 → 405	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues, including brain, bone marrow, lymph node, heart, lung, liver, pancreas, testis, ovary, and intestine. {ECO:0000269|PubMed:11604408}.

Sequence

MDSLVTANTKFCFDLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHF
NEFSQNESKEPDPCLKSNKQKAGSLNNESGLVSCYFGQLLSKLDRIKTDYTLSIANRLYG
EQEFPICQEYLDGVIQFYHTTIESVDFQKNPEKSRQEINFWVECQSQGKIKELFSKDAIN
AETVLVLVNAVYFKAKWETYFDHENTVDAPFCLNANENKSVKMMTQKGLYRIGFIEEVKA
QILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLSFP
RFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQAA
AATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP

Sequence length

405

Interactions

View interactions

Reactome Pathway
Neutrophil degranulation

Related Genes Genes most often co-reported with SERPINB12 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for SERPINB12.

Diseases Linked via Similar Genes Diseases curated for genes most similar to SERPINB12 (see Related Genes above), that are NOT already directly curated for SERPINB12 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to SERPINB12.

SERPINB12 (serpin family B member 12)

Bookmark This Gene