SERPINA9 (serpin family A member 9)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 327657
• Gene name: Serpin family A member 9
• Gene symbol: SERPINA9
• Synonyms (NCBI Gene): GCET1, SERPINA11, SERPINA11b
• Chromosome: 14
• Chromosome location: 14q32.13

miRNA Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1338624	hsa-miR-1202	CLIP-seq
MIRT1338625	hsa-miR-3194-5p	CLIP-seq
MIRT1338626	hsa-miR-324-5p	CLIP-seq
MIRT1338627	hsa-miR-3972	CLIP-seq
MIRT1338628	hsa-miR-4642	CLIP-seq
MIRT1338629	hsa-miR-4722-3p	CLIP-seq
MIRT1338630	hsa-miR-4795-5p	CLIP-seq
MIRT1338631	hsa-miR-1279	CLIP-seq
MIRT1338632	hsa-miR-4452	CLIP-seq
MIRT1338633	hsa-miR-4760-3p	CLIP-seq
MIRT2325006	hsa-miR-1225-3p	CLIP-seq
MIRT2325007	hsa-miR-3192	CLIP-seq
MIRT2325008	hsa-miR-4300	CLIP-seq
MIRT2325009	hsa-miR-4323	CLIP-seq
MIRT2325010	hsa-miR-920	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	15489334
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0016020	Component	Membrane	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA

Other IDs

• MIM: 615677
• HGNC: 15995
• e!Ensembl: ENSG00000170054

Protein

• UniProt ID: Q86WD7
• Protein name: Serpin A9 (Centerin) (Germinal center B-cell-expressed transcript 1 protein)
• Protein function: Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00079	Serpin	46 → 414	Serpin (serine protease inhibitor)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies. {ECO:0000269|PubMed:12819018, ECO:0000269|PubMed:17447896, ECO:0000269|PubMed:17898315, ECO:0000269|PubMed:18550480}.
• Sequence:

  MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLV
  LETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHS
  LTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVK
  KKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMM
  HQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQK
  RWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVS
  EEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS

• Sequence length: 417

Related Genes

No strongly related genes found yet for SERPINA9.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SERPINA9.