SERP2 (stress associated endoplasmic reticulum protein family member 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 387923
• Gene name: Stress associated endoplasmic reticulum protein family member 2
• Gene symbol: SERP2
• Synonyms (NCBI Gene): C13orf21, bA269C23.1
• Chromosome: 13
• Chromosome location: 13q14.11

miRNA Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1338576	hsa-miR-1468	CLIP-seq
MIRT1338577	hsa-miR-2355-3p	CLIP-seq
MIRT1338578	hsa-miR-3909	CLIP-seq
MIRT1338579	hsa-miR-676	CLIP-seq
MIRT2324984	hsa-miR-3660	CLIP-seq
MIRT2324985	hsa-miR-3913-3p	CLIP-seq
MIRT2324986	hsa-miR-4526	CLIP-seq
MIRT2324987	hsa-miR-489	CLIP-seq
MIRT2620489	hsa-miR-1245	CLIP-seq
MIRT2620490	hsa-miR-1275	CLIP-seq
MIRT2620491	hsa-miR-3616-5p	CLIP-seq
MIRT2620492	hsa-miR-3647-5p	CLIP-seq
MIRT2620493	hsa-miR-383	CLIP-seq
MIRT2324985	hsa-miR-3913-3p	CLIP-seq
MIRT2620494	hsa-miR-4270	CLIP-seq
MIRT2620495	hsa-miR-4441	CLIP-seq
MIRT2620496	hsa-miR-4447	CLIP-seq
MIRT2620497	hsa-miR-4472	CLIP-seq
MIRT2620498	hsa-miR-4525	CLIP-seq
MIRT2620499	hsa-miR-4665-5p	CLIP-seq
MIRT2620500	hsa-miR-4723-5p	CLIP-seq
MIRT2620501	hsa-miR-4772-5p	CLIP-seq
MIRT2620502	hsa-miR-4795-5p	CLIP-seq
MIRT2324987	hsa-miR-489	CLIP-seq
MIRT2620503	hsa-miR-573	CLIP-seq
MIRT2620504	hsa-miR-625	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006986	Process	Response to unfolded protein	IEA
GO:0016020	Component	Membrane	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8N6R1
• Protein name: Stress-associated endoplasmic reticulum protein 2 (Ribosome-associated membrane protein RAMP4-2)
• Protein function: Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06624	RAMP4	2 → 61	Ribosome associated membrane protein RAMP4	Family

• Sequence:

  MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQS
  IRMGM

• Sequence length: 65

Related Genes

No strongly related genes found yet for SERP2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SERP2.