SERHL (serine hydrolase like (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 94009
Gene name Serine hydrolase like (pseudogene)
Gene symbol SERHL
Synonyms (NCBI Gene)
BK126B4.1BK126B4.2HS126B42dJ222E13.1
Chromosome 22
Chromosome location 22q13.2
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT004221 hsa-miR-346 Microarray 16822819
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0016787 Function Hydrolase activity IBA
GO:0016787 Function Hydrolase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607979 14408 ENSG00000293485
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NQF3
Protein name Serine hydrolase-like protein (SHL) (EC 3.1.-.-)
Protein function Putative serine hydrolase.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00561 Abhydrolase_1 33 → 190 alpha/beta hydrolase fold Domain
Sequence 
MAENAAPGLISELKLAVPWGHIAAKAWGSLQGPPVLCLHGWLDNASSFDRLIPLLPQDFY
YVAMDFGGHGLSSHYSPGVPYYLQTFVSEIRRVVAALKWNRFSILGHSFGGVVGGMFFCT
FPEMVDKLILLDTPLFLLESDEMENLLTYKRRAIEHVLQVEASQEPSHVFSLKQLLQRQR
TALTSSAGSCVRIPSGSCRPMSC
Sequence length 203
Interactions View interactions

No strongly related genes found yet for SERHL.

No additional diseases found yet through genes similar to SERHL.