SELENOT (selenoprotein T)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51714
• Gene name: Selenoprotein T
• Gene symbol: SELENOT
• Synonyms (NCBI Gene): SELT
• Chromosome: 3
• Chromosome location: 3q25.1
• Summary: This gene encodes a selenoprotein, containing a selenocysteine (Sec) residue at the active site. Sec is encoded by the UGA codon that normally signals translation termination. The 3` UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT468636	hsa-miR-5700	PAR-CLIP	23592263
MIRT468635	hsa-miR-548aj-5p	PAR-CLIP	23592263
MIRT468634	hsa-miR-548f-5p	PAR-CLIP	23592263
MIRT468633	hsa-miR-548g-5p	PAR-CLIP	23592263
MIRT468632	hsa-miR-548x-5p	PAR-CLIP	23592263
MIRT468631	hsa-miR-1468-3p	PAR-CLIP	23592263
MIRT468630	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT468629	hsa-miR-548aw	PAR-CLIP	23592263
MIRT468628	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT468627	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT468626	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT161324	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT161328	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT161323	hsa-miR-32-5p	HITS-CLIP	22473208

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001514	Process	Selenocysteine incorporation	NAS	10567350
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	IBA
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	IEA
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0008430	Function	Selenium binding	NAS	10567350
GO:0009749	Process	Response to glucose	IEA
GO:0009749	Process	Response to glucose	ISS
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031016	Process	Pancreas development	IEA
GO:0031016	Process	Pancreas development	ISS
GO:0035773	Process	Insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035773	Process	Insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0045454	Process	Cell redox homeostasis	IDA	26866473
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0060124	Process	Positive regulation of growth hormone secretion	IEA
GO:0060124	Process	Positive regulation of growth hormone secretion	ISS
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0098869	Process	Cellular oxidant detoxification	ISS

Other IDs

• MIM: 607912
• HGNC: 18136
• e!Ensembl: ENSG00000198843

Protein

• UniProt ID: P62341
• Protein name: Thioredoxin reductase-like selenoprotein T (SelT) (EC 1.8.1.9)
• Protein function: Selenoprotein with thioredoxin reductase-like oxidoreductase activity (By similarity). Protects dopaminergic neurons against oxidative stress and cell death (PubMed:26866473). Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendoc
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10262	Rdx	40 → 179	Rdx family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highly expressed in the endocrine pancreas. {ECO:0000269|PubMed:23913443}.
• Sequence:

  MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMR
  VISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQW
  GQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNE
  MKLNVHMDSIPHHRS

• Sequence length: 195

Related Genes

No strongly related genes found yet for SELENOT.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SELENOT.