SELENOM (selenoprotein M)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 140606
Gene name Selenoprotein M
Gene symbol SELENOM
Synonyms (NCBI Gene)
SELMSEPM
Chromosome 22
Chromosome location 22q12.2
Summary The protein encoded by this gene belongs to the selenoprotein M/SEP15 family. The exact function of this protein is not known. It is localized in the perinuclear region, is highly expressed in the brain, and may be involved in neurodegenerative disorders.
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005788 Component Endoplasmic reticulum lumen IBA
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610918 30397 ENSG00000198832
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WWX9
Protein name Selenoprotein M (SelM)
Protein function May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08806 Sep15_SelM 40 → 114 Sep15/SelM redox domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11839807}.
Sequence 
MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGGUQLNRLKEVKAFV
TQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAP
DAQVPPEYVWAPAKPPEETSDHADL
Sequence length 145
Interactions View interactions

No strongly related genes found yet for SELENOM.

No additional diseases found yet through genes similar to SELENOM.