SELE (selectin E)

Gene

• Entrez ID: 6401
• Gene name: Selectin E
• Gene symbol: SELE
• Synonyms (NCBI Gene): CD62E, ELAM, ELAM1, ESEL, LECAM2, selectin-e
• Chromosome: 1
• Chromosome location: 1q24.2
• Summary: The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits st

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004019	hsa-miR-31-5p	Immunocytochemistry, Northern blot, qRT-PCR, Western blot	19949084
MIRT005711	hsa-miR-17-5p	Luciferase reporter assay	19949084
MIRT005712	hsa-miR-17-3p	Luciferase reporter assay	19949084
MIRT005713	hsa-miR-155-5p	Luciferase reporter assay	19949084
MIRT005714	hsa-miR-221-3p	Luciferase reporter assay	19949084
MIRT005715	hsa-miR-222-3p	Luciferase reporter assay	19949084
MIRT005716	hsa-miR-1256	Luciferase reporter assay	19949084
MIRT722477	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT722476	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722475	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT722474	hsa-miR-630	HITS-CLIP	19536157
MIRT722473	hsa-miR-3686	HITS-CLIP	19536157
MIRT722472	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT722471	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT739056	hsa-miR-204	HITS-CLIP	33718276
MIRT739057	hsa-miR-623	HITS-CLIP	33718276
MIRT722477	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT722476	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722475	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT722474	hsa-miR-630	HITS-CLIP	19536157
MIRT722473	hsa-miR-3686	HITS-CLIP	19536157
MIRT722472	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT722471	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT1334249	hsa-miR-203	CLIP-seq
MIRT739055	hsa-miR-211	CLIP-seq
MIRT739059	hsa-miR-4446-5p	CLIP-seq
MIRT1334250	hsa-miR-4699-3p	CLIP-seq
MIRT739058	hsa-miR-4755-5p	CLIP-seq
MIRT2098902	hsa-miR-1236	CLIP-seq
MIRT2098903	hsa-miR-141	CLIP-seq
MIRT2098904	hsa-miR-200a	CLIP-seq
MIRT2098905	hsa-miR-377	CLIP-seq
MIRT2098906	hsa-miR-412	CLIP-seq
MIRT2098907	hsa-miR-759	CLIP-seq
MIRT2098908	hsa-miR-924	CLIP-seq
MIRT2323709	hsa-miR-1202	CLIP-seq
MIRT2323710	hsa-miR-1245	CLIP-seq
MIRT2323711	hsa-miR-151-5p	CLIP-seq
MIRT2323712	hsa-miR-151b	CLIP-seq
MIRT2323713	hsa-miR-3150b-3p	CLIP-seq
MIRT2323714	hsa-miR-3972	CLIP-seq
MIRT2323715	hsa-miR-4307	CLIP-seq
MIRT2323716	hsa-miR-4317	CLIP-seq
MIRT2323717	hsa-miR-4640-5p	CLIP-seq
MIRT2323718	hsa-miR-4716-5p	CLIP-seq
MIRT2323719	hsa-miR-4726-5p	CLIP-seq
MIRT2323720	hsa-miR-4784	CLIP-seq
MIRT2323721	hsa-miR-515-5p	CLIP-seq
MIRT2459064	hsa-miR-4729	CLIP-seq
MIRT2459065	hsa-miR-4803	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF3	Repression	10964678
HOXA9	Unknown	22269951
NFKB1	Activation	10946302;12408953;12885753;19422386
NFKB1	Unknown	8878392
REL	Activation	12408953
RELA	Activation	10946302;12885753;19422386
RELA	Unknown	11827962;23042817;8878392
SIRT1	Unknown	21810449
STAT6	Repression	9092569

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002092	Process	Positive regulation of receptor internalization	IDA	9312078
GO:0002523	Process	Leukocyte migration involved in inflammatory response	TAS	18029551
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IMP	12960351
GO:0005515	Function	Protein binding	IPI	18606703, 32814053
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005886	Component	Plasma membrane	IDA	28011641
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2466335
GO:0005901	Component	Caveola	IDA	12960351
GO:0005905	Component	Clathrin-coated pit	IDA	18029551
GO:0006954	Process	Inflammatory response	TAS	2466335
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	18029551
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	7680663
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	12960351
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0019722	Process	Calcium-mediated signaling	TAS	12960351
GO:0030029	Process	Actin filament-based process	IDA	8609175
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030863	Component	Cortical cytoskeleton	IDA	8609175
GO:0032496	Process	Response to lipopolysaccharide	TAS	18029551
GO:0033691	Function	Sialic acid binding	IBA
GO:0033691	Function	Sialic acid binding	IDA	7680663
GO:0034097	Process	Response to cytokine	IBA
GO:0034612	Process	Response to tumor necrosis factor	TAS	18029551
GO:0043274	Function	Phospholipase binding	IDA	12960351
GO:0045121	Component	Membrane raft	IDA	18029551
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12960351
GO:0050727	Process	Regulation of inflammatory response	TAS	18029551
GO:0050900	Process	Leukocyte migration	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IBA
GO:0050901	Process	Leukocyte tethering or rolling	IEA
GO:0050901	Process	Leukocyte tethering or rolling	IMP	18029551
GO:0070492	Function	Oligosaccharide binding	IBA
GO:0070492	Function	Oligosaccharide binding	IDA	7680663
GO:0070492	Function	Oligosaccharide binding	IEA
GO:0070555	Process	Response to interleukin-1	IDA	8609175
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	IEA
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	ISS

Other IDs

• MIM: 131210
• HGNC: 10718
• e!Ensembl: ENSG00000007908

Protein

• UniProt ID: P16581
• Protein name: E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
• Protein function: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis. {ECO:0000269|PubMed:168
• PDB: 1ESL, 1G1T, 4C16, 4CSY, 6EYI, 6EYJ, 6EYK, 8R5L, 8R5M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	29 → 140	Lectin C-type domain	Domain
  PF00008	EGF	143 → 173	EGF-like domain	Domain
  PF00084	Sushi	180 → 237	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	242 → 299	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	304 → 362	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	367 → 425	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	430 → 488	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	493 → 547	Sushi repeat (SCR repeat)	Domain

• Sequence:

  MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
  SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
  DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
  TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
  ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
  AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
  VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
  EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
  WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
  SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
  GSYQKPSYIL

• Sequence length: 610

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary artery disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IgA nephropathy, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25147432		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	17532767		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30204466		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28007459		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10232599, 7591266		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	7591266		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30204466		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	17057786		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21521525		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	15925831		★☆☆☆☆ Found in Text Mining only
Alopecia universalis	Alopecia universalis	Pubtator	7511865	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	11054140, 18513389	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	24551209	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	9371854	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	15795541, 27686084, 30404812, 31672902		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	19111481	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	26687477	Associate	★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	24066042		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	24066042	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37014642	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	10917982	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	30529828		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	11127470	Associate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	1281620, 1704191	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10430030, 10699426, 11466561, 14575520, 15179350, 15546947, 16908800, 19420919, 19942746, 21411607, 21629188, 22648254, 24249306, 27826542, 28441665, 29288721, 29565737, 29970364, 30165141, 30501958, 30919407, 31543373, 31632584, 7533025, 8557254, 8578482		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	LHGDN	15784173		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	21739422	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11310827, 7693825	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17852775	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10885418, 17563404, 7512004, 7545095	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12165540, 17563404, 7542080		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10430030, 10699426, 11466561, 14575520, 15179350, 15546947, 16908800, 19420919, 19942746, 21411607, 21629188, 22648254, 24249306, 27826542, 28441665, 29288721, 29565737, 29970364, 30165141, 30501958, 30919407, 31543373, 31632584, 7533025, 8557254, 8578482		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11231628, 11466561, 15546947, 15591119, 15784173, 17885011, 19942746, 21496279, 21659524, 22648254, 26647279, 27454768, 28701173, 28821884, 30919407, 37014642	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15179350		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	17890461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	LHGDN	17996280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27671694		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	27706780	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29487871, 31507371		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10333719	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10627429	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16611372		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	LHGDN	18704886		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	15546947	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17394460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	17167725, 20927342, 23129313, 24658642, 24818768, 25339657, 25815697, 26828984, 26872904, 28789438, 29777742, 31719877, 8669817		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12172576, 12841680, 18350162, 22970241, 22983139, 22992472	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	9094987	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	11106214	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	8915211	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	8915211		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	15009098		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	LHGDN	15009098, 17515951		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	9495363		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	29215790	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18057713, 35637248	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	23353989	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30662525		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26943029	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35063404	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16309209	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18794336, 22718118, 33907270	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	15546947	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	12898464		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12898464, 14675775, 15833936, 20191078, 22808171, 24418879, 24699314, 25147432, 30653588	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	16332659, 16544732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16843446, 23300549, 25147432, 26659566, 27774694, 28202840, 29891747, 30479668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	LHGDN	16554320		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	16554320, 24151105		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	20044088, 25441669	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16916660		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	16916660		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18471997		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	20622166, 37015819	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19420919, 20941749, 24249306, 25168603, 30983125, 31822249		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	16843446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30204466		★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	26472821	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	16554320, 17875185, 24151105, 29891747		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30617956, 31514183, 31664940		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28844188, 30917206		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	24995349, 7523818		★☆☆☆☆ Found in Text Mining only
Chudley-Mccullough syndrome	Chudley-Mccullough Syndrome	BEFREE	25857959		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	39991918	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35253509, 9771404	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11831392, 12820726, 14630701, 16565092, 9578490, 9872604		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11448946, 16565092, 21283832, 21722370	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17684030		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12359742, 19361981, 20336782, 27775438, 27926494, 30742932, 9495363		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15141079, 17372905, 21521691, 21722370, 22547830, 27926494, 29402939, 33167483, 33845603, 34497681	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15254658		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30165141		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	10209523	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10465332, 19360351		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11466561, 15013273, 16061120, 16756647, 17578587, 18649056, 19564823, 19942746, 21629188, 24260191, 24458828, 9020385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10699426, 11168027, 12036529, 15013273, 16061120, 16756647, 17578587, 18649056, 19564823, 19942746, 21629188, 22116284, 24260191, 24458828, 31572467, 9020385		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11466561, 16756647, 19942746, 21629188, 24699314, 35768776	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12940514, 16756647, 17578587, 18649056		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	12390284, 17578587, 22388798, 39344313	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15013273, 16061120, 16756647, 17578587, 18649056, 19564823, 19942746, 21629188, 24260191, 24458828, 24504449, 9020385, 9668170		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	15546947	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	9771404	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	28821422		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21750942, 30468518		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26289958		★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	7512530	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11981814	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	1708785	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	33318199, 7684425	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	16575390	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	17597826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	11981814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	11981814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	12410700		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	8800304	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15833936, 27377657, 30334082, 31280040		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12945002	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15013273, 15833936, 16843446, 27377657, 29974394, 30334082, 31280040		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15833936, 19942746, 28927403, 36765354	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	16843446		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34682638	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12388172, 34682638	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17578587, 20147318, 21659524	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19729612, 23300549, 26122942, 30710485		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	11935152, 17578587		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12388172, 15013273, 15833936, 17578587, 20147318, 26872904, 29121940, 31280040, 31783601, 9562351		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36949528	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	15666579		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27377657		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	25341845		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29777742		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	29777742		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	LHGDN	12738381		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	17578587		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11981814		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	12410700		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17659325	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24133580		★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	31383782	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	31746731		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	15083893		★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	LHGDN	15083893		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	20796317, 22158116, 25003340, 29178542		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	20796317, 25748737, 25945941	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	LHGDN	18707907		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23532958		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	39621304	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30854694		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	29392310		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	LHGDN	12738381		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	19414551	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	10736107	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	10643715	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	18197885		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	7685818		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	11231628, 19401404, 26396484	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26396484		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	16862071, 8889553	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	22419694, 29791907		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	11828340, 16974056	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	1370927	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	18094708, 23242661		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	7586686	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	9075611	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	9158103	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	7586686	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	16185922	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30165141		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	20056442	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	33954832	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	20193033		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	27926494	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1605306	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	14602771		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	BEFREE	16843446, 18649056		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	LHGDN	16843446, 18649056		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	10699426, 28024183, 28438163		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	24702436, 27141013		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	28024183, 31543373		★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Hypersensitivity	Pubtator	1704193	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19942746, 20796317, 21881522, 25424718, 25748737, 35194526	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	14705225, 15076188, 21881522, 25424718		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15076188		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12829075	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11828340		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	16974056		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	31805421		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	14559828		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29523900		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10563674, 31534535		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	7541009, 9771404	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	12032865		★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal Perforation	BEFREE	24980946		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28272703		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29215790		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19420919, 20941749, 21257828, 22589243, 24249306, 25168603, 28093478		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	21739422		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	7504714, 7692824		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26659566		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35891358	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	16974056	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26659566, 28740545, 28841902, 30371703		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	15593054, 16554320, 17875185		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	16554320, 17875185, 24151105, 29891747		★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	8697637	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10640966, 27926494		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27926494	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12186696, 35924822	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10339484	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12186696		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27577048		★☆☆☆☆ Found in Text Mining only
Leukocyte-Adhesion Deficiency Syndrome	Leukocyte adhesion deficiency	BEFREE	11350525		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18490455		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14607629		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	23532958		★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	33954832	Stimulate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	30618531, 31157654		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28698503, 9543276	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10329599, 9543276	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11936588		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20044088, 24699314, 35332100, 7694552	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24083390, 30638300	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11764211, 15954900, 29096830, 30638300		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	11764211, 18991188		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	15086468		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27926494, 7691638		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	27926494	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	12011765		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	12388172, 21219847	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	17057786	Associate	★☆☆☆☆ Found in Text Mining only
Maculopathy with diabetes mellitus	Diabetic maculopathy	BEFREE	12388172		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31664940		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17167725, 20927342, 23129313, 24658642, 24818768, 25339657, 25815697, 26828984, 26872904, 27176937, 28789438, 29777742, 31719877, 8669817		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30662525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20607758, 22766603, 28765175		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14559828, 21281819, 24178760, 24526735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16773720, 21780194, 23015400, 9627176		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	1280420, 15141079, 17695536, 17961927, 18593916, 20607758, 23015400, 24815478, 28404918, 28698503, 29402939, 29716546, 30988423, 31719877		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11831392, 25213663, 9578490		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12172576, 17167725		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27220365		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	1370233, 25138157	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21795970, 31444891, 7508820, 8824559		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	23353989		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33800494	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	14557872, 29400123, 30008151, 31550292, 31758356		★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	36726727	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31476158		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	25605650	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	31396494		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28439107		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	38243063	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10335519, 15979159, 31507371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	10705303	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	20175758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	20175758		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	17532767		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31018977		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12649084, 14575520, 15013273, 17964560, 24458828, 24504449, 24639176, 26662939, 31572467, 9668170		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12649084		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	16820586, 20191078	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial necrosis	Myocardial necrosis	BEFREE	17964560		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	10440498	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24995349		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	24995349	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	39744943	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31383782		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11119416, 12032865, 1280420, 12820726, 14533809, 14559828, 14630701, 16565092, 17405903, 17695536, 18794336, 19331173, 19492143, 21327325, 21780194, 21795970, 21978830, 22718118, 23353989, 24128856, 24818768, 25456953, 26509633, 26828984, 27775438, 27885671, 28552267, 28576551, 29215790, 29716546, 30110551, 30687313, 31101754, 31355333, 31642986, 31719877, 8834768, 9537262, 9627176		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29156825		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	18490455		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	9160678		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28698503, 31793656		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29228174		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	12898464	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15076188		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32985079	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25659662	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	24658642		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20607758, 22766603, 28765175, 7532161		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	18580442		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	33178497	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25456953		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	17189976	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29048735		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	17890461		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	17515951	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	11350525		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11896824, 18973547		★☆☆☆☆ Found in Text Mining only
PIK3CA related overgrowth spectrum	Overgrowth Spectrum	BEFREE	31490637		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	31746731		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	29096830		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18245480		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	26289958		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14559828, 21281819, 24178760, 24526735		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10855628, 18647941, 19889975, 21281819, 24386459	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	9551397	Associate	★☆☆☆☆ Found in Text Mining only
Proteus Syndrome	Proteus Syndrome	BEFREE	31490637		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	24658642		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	LHGDN	18191640		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11310827, 27774694, 28489469, 29089115		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29228174		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	24083390	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30532530	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	36230894	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	14705225		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	7521737		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	23772946		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10465332, 19360351		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27671694		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	29523900		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	27377657		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12643440, 17014013, 1722512, 20490888, 28756336, 29487871, 30008151, 31820195, 7540009, 8607896		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15515123, 17014013, 17963163		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15083893		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	15083893		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	7514516	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28784104		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	7507301	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	12905480	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	12905480	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24083390	Stimulate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	10477399	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16982492, 23669075, 24576991, 28840836, 29565737, 30542424		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	8509947		★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	BEFREE	31746731		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	9064342	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27896929		★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	25441669		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12792758, 18794336		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18794336, 22718118		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10777581, 16309209	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23532958		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16773720, 21780194, 23015400, 9627176		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12738381, 16773720		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16773720, 17695536, 23015400, 9683305	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	20191078	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	8509947		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	8509947		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	1371389, 1457282, 14705225, 29487871		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	19508974, 22190201	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	20431848, 22190201		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	25576172		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31355333		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19212205		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	12121561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicosity	Vulval varices	BEFREE	20632821		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	11231628, 15833936, 26761204, 27884380, 33546604	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15013273, 15954900, 9562351		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33954832, 9152314	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	33608030	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis of the skin	Vasculitis	BEFREE	12488365, 23457623		★☆☆☆☆ Found in Text Mining only