Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	81929
Gene name	SEH1 like nucleoporin
Gene symbol	SEH1L
Synonyms (NCBI Gene)	SEC13LSEH1ASEH1BSeh1
Chromosome	18
Chromosome location	18p11.21
Summary	The protein encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including th

240 Show/Hide all (240)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003158	hsa-miR-210-3p	immunoprecipitaionMicroarrayqRT-PCR	19826008
MIRT031586	hsa-miR-16-5p	Sequencing	20371350
MIRT622316	hsa-miR-6508-5p	HITS-CLIP	23824327
MIRT622315	hsa-miR-8067	HITS-CLIP	23824327
MIRT622314	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT622313	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT290167	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT346278	hsa-miR-4422	PAR-CLIP	23446348
MIRT290168	hsa-miR-3646	PAR-CLIP	23446348
MIRT290169	hsa-miR-5680	PAR-CLIP	23446348
MIRT468649	hsa-miR-4476	PAR-CLIP	23592263
MIRT468648	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468647	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468646	hsa-miR-4487	PAR-CLIP	23592263
MIRT468645	hsa-miR-4533	PAR-CLIP	23592263
MIRT468644	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT468643	hsa-miR-765	PAR-CLIP	23592263
MIRT468642	hsa-miR-4475	PAR-CLIP	23592263
MIRT468641	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT468640	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT468639	hsa-miR-4518	PAR-CLIP	23592263
MIRT468638	hsa-miR-6089	PAR-CLIP	23592263
MIRT468637	hsa-miR-6892-5p	PAR-CLIP	23592263
MIRT622316	hsa-miR-6508-5p	HITS-CLIP	23824327
MIRT622315	hsa-miR-8067	HITS-CLIP	23824327
MIRT622314	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT622313	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT290167	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT346278	hsa-miR-4422	PAR-CLIP	23446348
MIRT290168	hsa-miR-3646	PAR-CLIP	23446348
MIRT290169	hsa-miR-5680	PAR-CLIP	23446348
MIRT468649	hsa-miR-4476	PAR-CLIP	23592263
MIRT468648	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468647	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468646	hsa-miR-4487	PAR-CLIP	23592263
MIRT468645	hsa-miR-4533	PAR-CLIP	23592263
MIRT468644	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT468643	hsa-miR-765	PAR-CLIP	23592263
MIRT468642	hsa-miR-4475	PAR-CLIP	23592263
MIRT468641	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT468640	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT468639	hsa-miR-4518	PAR-CLIP	23592263
MIRT468638	hsa-miR-6089	PAR-CLIP	23592263
MIRT468637	hsa-miR-6892-5p	PAR-CLIP	23592263
MIRT1333959	hsa-miR-128	CLIP-seq
MIRT1333960	hsa-miR-141	CLIP-seq
MIRT1333961	hsa-miR-154	CLIP-seq
MIRT1333962	hsa-miR-200a	CLIP-seq
MIRT1333963	hsa-miR-2054	CLIP-seq
MIRT1333964	hsa-miR-23a	CLIP-seq
MIRT1333965	hsa-miR-23b	CLIP-seq
MIRT1333966	hsa-miR-23c	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333969	hsa-miR-3160-5p	CLIP-seq
MIRT1333970	hsa-miR-323b-5p	CLIP-seq
MIRT1333971	hsa-miR-3616-5p	CLIP-seq
MIRT1333972	hsa-miR-3647-5p	CLIP-seq
MIRT1333973	hsa-miR-374c	CLIP-seq
MIRT1333974	hsa-miR-4318	CLIP-seq
MIRT1333975	hsa-miR-4520a-3p	CLIP-seq
MIRT1333976	hsa-miR-4520b-3p	CLIP-seq
MIRT1333977	hsa-miR-4662a-5p	CLIP-seq
MIRT1333978	hsa-miR-4676-5p	CLIP-seq
MIRT1333979	hsa-miR-4693-5p	CLIP-seq
MIRT1333980	hsa-miR-4742-3p	CLIP-seq
MIRT1333981	hsa-miR-4778-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1333983	hsa-miR-573	CLIP-seq
MIRT1333984	hsa-miR-575	CLIP-seq
MIRT1333985	hsa-miR-622	CLIP-seq
MIRT1333986	hsa-miR-630	CLIP-seq
MIRT1333987	hsa-miR-655	CLIP-seq
MIRT1333988	hsa-miR-890	CLIP-seq
MIRT1333989	hsa-miR-892a	CLIP-seq
MIRT1333990	hsa-miR-106a	CLIP-seq
MIRT1333991	hsa-miR-106b	CLIP-seq
MIRT1333992	hsa-miR-150	CLIP-seq
MIRT1333993	hsa-miR-17	CLIP-seq
MIRT1333994	hsa-miR-1914	CLIP-seq
MIRT1333995	hsa-miR-20a	CLIP-seq
MIRT1333996	hsa-miR-20b	CLIP-seq
MIRT1333997	hsa-miR-2110	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333998	hsa-miR-28-5p	CLIP-seq
MIRT1333999	hsa-miR-3139	CLIP-seq
MIRT1334000	hsa-miR-3179	CLIP-seq
MIRT1334001	hsa-miR-3202	CLIP-seq
MIRT1334002	hsa-miR-3609	CLIP-seq
MIRT1334003	hsa-miR-3653	CLIP-seq
MIRT1334004	hsa-miR-3658	CLIP-seq
MIRT1334005	hsa-miR-3672	CLIP-seq
MIRT1334006	hsa-miR-3689a-3p	CLIP-seq
MIRT1334007	hsa-miR-3689c	CLIP-seq
MIRT1334008	hsa-miR-3938	CLIP-seq
MIRT1334009	hsa-miR-4271	CLIP-seq
MIRT1334010	hsa-miR-4315	CLIP-seq
MIRT1334011	hsa-miR-4330	CLIP-seq
MIRT1334012	hsa-miR-4667-3p	CLIP-seq
MIRT1334013	hsa-miR-4667-5p	CLIP-seq
MIRT1334014	hsa-miR-4700-5p	CLIP-seq
MIRT1334015	hsa-miR-4725-3p	CLIP-seq
MIRT1334016	hsa-miR-4731-5p	CLIP-seq
MIRT1334017	hsa-miR-4747-5p	CLIP-seq
MIRT1334018	hsa-miR-4790-3p	CLIP-seq
MIRT1334019	hsa-miR-4790-5p	CLIP-seq
MIRT1334020	hsa-miR-4796-3p	CLIP-seq
MIRT1334021	hsa-miR-4802-3p	CLIP-seq
MIRT1334022	hsa-miR-510	CLIP-seq
MIRT1334023	hsa-miR-512-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1334024	hsa-miR-519d	CLIP-seq
MIRT1334025	hsa-miR-526b	CLIP-seq
MIRT1334026	hsa-miR-548ah	CLIP-seq
MIRT1334027	hsa-miR-587	CLIP-seq
MIRT1334028	hsa-miR-606	CLIP-seq
MIRT1334029	hsa-miR-708	CLIP-seq
MIRT1334030	hsa-miR-93	CLIP-seq
MIRT2098802	hsa-miR-1283	CLIP-seq
MIRT1333960	hsa-miR-141	CLIP-seq
MIRT1333962	hsa-miR-200a	CLIP-seq
MIRT1333963	hsa-miR-2054	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT2098803	hsa-miR-3166	CLIP-seq
MIRT2098804	hsa-miR-3182	CLIP-seq
MIRT1333970	hsa-miR-323b-5p	CLIP-seq
MIRT1333973	hsa-miR-374c	CLIP-seq
MIRT1334011	hsa-miR-4330	CLIP-seq
MIRT2098805	hsa-miR-4643	CLIP-seq
MIRT2098806	hsa-miR-4696	CLIP-seq
MIRT1333980	hsa-miR-4742-3p	CLIP-seq
MIRT2098807	hsa-miR-4766-5p	CLIP-seq
MIRT2098808	hsa-miR-4771	CLIP-seq
MIRT1333981	hsa-miR-4778-5p	CLIP-seq
MIRT2098809	hsa-miR-4794	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT2098810	hsa-miR-548c-3p	CLIP-seq
MIRT2098811	hsa-miR-548g	CLIP-seq
MIRT2098812	hsa-miR-548p	CLIP-seq
MIRT1333986	hsa-miR-630	CLIP-seq
MIRT1333987	hsa-miR-655	CLIP-seq
MIRT2323550	hsa-miR-105	CLIP-seq
MIRT2323551	hsa-miR-1244	CLIP-seq
MIRT2098802	hsa-miR-1283	CLIP-seq
MIRT2323552	hsa-miR-132	CLIP-seq
MIRT2323553	hsa-miR-138	CLIP-seq
MIRT2323554	hsa-miR-145	CLIP-seq
MIRT1333961	hsa-miR-154	CLIP-seq
MIRT2323555	hsa-miR-15a	CLIP-seq
MIRT2323556	hsa-miR-15b	CLIP-seq
MIRT2323557	hsa-miR-16	CLIP-seq
MIRT2323558	hsa-miR-194	CLIP-seq
MIRT2323559	hsa-miR-195	CLIP-seq
MIRT2323560	hsa-miR-200b	CLIP-seq
MIRT2323561	hsa-miR-200c	CLIP-seq
MIRT2323562	hsa-miR-208a	CLIP-seq
MIRT2323563	hsa-miR-208b	CLIP-seq
MIRT1333997	hsa-miR-2110	CLIP-seq
MIRT2323564	hsa-miR-212	CLIP-seq
MIRT1333998	hsa-miR-28-5p	CLIP-seq
MIRT2323565	hsa-miR-3120-3p	CLIP-seq
MIRT2323566	hsa-miR-3121-5p	CLIP-seq
MIRT2323567	hsa-miR-3130-5p	CLIP-seq
MIRT1333999	hsa-miR-3139	CLIP-seq
MIRT2323568	hsa-miR-3145-5p	CLIP-seq
MIRT2323569	hsa-miR-3163	CLIP-seq
MIRT2098803	hsa-miR-3166	CLIP-seq
MIRT1334000	hsa-miR-3179	CLIP-seq
MIRT2098804	hsa-miR-3182	CLIP-seq
MIRT1334001	hsa-miR-3202	CLIP-seq
MIRT2323570	hsa-miR-3662	CLIP-seq
MIRT2323571	hsa-miR-369-3p	CLIP-seq
MIRT2323572	hsa-miR-3925-3p	CLIP-seq
MIRT2323573	hsa-miR-3974	CLIP-seq
MIRT2323574	hsa-miR-424	CLIP-seq
MIRT2323575	hsa-miR-4269	CLIP-seq
MIRT1334009	hsa-miR-4271	CLIP-seq
MIRT2323576	hsa-miR-4282	CLIP-seq
MIRT2323577	hsa-miR-429	CLIP-seq
MIRT2323578	hsa-miR-4326	CLIP-seq
MIRT2323579	hsa-miR-4432	CLIP-seq
MIRT2323580	hsa-miR-4436a	CLIP-seq
MIRT2323581	hsa-miR-4482	CLIP-seq
MIRT1333975	hsa-miR-4520a-3p	CLIP-seq
MIRT1333976	hsa-miR-4520b-3p	CLIP-seq
MIRT1334013	hsa-miR-4667-5p	CLIP-seq
MIRT2323582	hsa-miR-4690-5p	CLIP-seq
MIRT2323583	hsa-miR-4700-3p	CLIP-seq
MIRT1334014	hsa-miR-4700-5p	CLIP-seq
MIRT2323584	hsa-miR-4720-3p	CLIP-seq
MIRT1334015	hsa-miR-4725-3p	CLIP-seq
MIRT1334016	hsa-miR-4731-5p	CLIP-seq
MIRT1334017	hsa-miR-4747-5p	CLIP-seq
MIRT2323585	hsa-miR-4761-5p	CLIP-seq
MIRT2323586	hsa-miR-4762-5p	CLIP-seq
MIRT2098807	hsa-miR-4766-5p	CLIP-seq
MIRT2098808	hsa-miR-4771	CLIP-seq
MIRT2323587	hsa-miR-4773	CLIP-seq
MIRT2098809	hsa-miR-4794	CLIP-seq
MIRT2323588	hsa-miR-4804-3p	CLIP-seq
MIRT2323589	hsa-miR-490-3p	CLIP-seq
MIRT2323590	hsa-miR-494	CLIP-seq
MIRT2323591	hsa-miR-497	CLIP-seq
MIRT2323592	hsa-miR-499-5p	CLIP-seq
MIRT2323593	hsa-miR-508-5p	CLIP-seq
MIRT2323594	hsa-miR-5095	CLIP-seq
MIRT2323595	hsa-miR-545	CLIP-seq
MIRT2098810	hsa-miR-548c-3p	CLIP-seq
MIRT2098811	hsa-miR-548g	CLIP-seq
MIRT2098812	hsa-miR-548p	CLIP-seq
MIRT1334027	hsa-miR-587	CLIP-seq
MIRT2323596	hsa-miR-607	CLIP-seq
MIRT2323597	hsa-miR-649	CLIP-seq
MIRT1334029	hsa-miR-708	CLIP-seq
MIRT2323598	hsa-miR-873	CLIP-seq
MIRT2323599	hsa-miR-888	CLIP-seq
MIRT1333988	hsa-miR-890	CLIP-seq
MIRT1333961	hsa-miR-154	CLIP-seq
MIRT2323566	hsa-miR-3121-5p	CLIP-seq
MIRT2323567	hsa-miR-3130-5p	CLIP-seq
MIRT2098803	hsa-miR-3166	CLIP-seq
MIRT2323578	hsa-miR-4326	CLIP-seq
MIRT2323581	hsa-miR-4482	CLIP-seq
MIRT2098808	hsa-miR-4771	CLIP-seq
MIRT1333959	hsa-miR-128	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333974	hsa-miR-4318	CLIP-seq
MIRT1333979	hsa-miR-4693-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1333989	hsa-miR-892a	CLIP-seq
MIRT1333959	hsa-miR-128	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333974	hsa-miR-4318	CLIP-seq
MIRT1333979	hsa-miR-4693-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1333989	hsa-miR-892a	CLIP-seq

41 Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	15146057, 17363900
GO:0000776	Component	Kinetochore	IEA
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	24315095, 26391640, 26496610, 26972053, 27194810, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	24315095
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IEA
GO:0005643	Component	Nuclear pore	NAS	24315095
GO:0005694	Component	Chromosome	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	28199306
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006913	Process	Nucleocytoplasmic transport	NAS	27016207
GO:0006999	Process	Nuclear pore organization	IMP	15146057
GO:0007059	Process	Chromosome segregation	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	17363900
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0031080	Component	Nuclear pore outer ring	IBA
GO:0031080	Component	Nuclear pore outer ring	IDA	17360435
GO:0031080	Component	Nuclear pore outer ring	NAS	15146057, 17363900
GO:0031503	Process	Protein-containing complex localization	IMP	23723238
GO:0031669	Process	Cellular response to nutrient levels	IDA	35831510, 36528027
GO:0034198	Process	Cellular response to amino acid starvation	IBA
GO:0034198	Process	Cellular response to amino acid starvation	IMP	23723238
GO:0035859	Component	Seh1-associated complex	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0051301	Process	Cell division	IEA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	17363900
GO:0061700	Component	GATOR2 complex	IDA	35831510, 36528027
GO:0061700	Component	GATOR2 complex	NAS	23723238
GO:1904262	Process	Negative regulation of TORC1 signaling	NAS	23723238
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	35831510, 36528027
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	25457612
GO:1904263	Process	Positive regulation of TORC1 signaling	NAS	23723238

MIM	HGNC	e!Ensembl
609263	30379	ENSG00000085415

Q96EE3

Protein name

Nucleoporin SEH1 (GATOR2 complex protein SEH1) (Nup107-160 subcomplex subunit SEH1) (SEC13-like protein)

Protein function

Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC (PubMed:15146057, PubMed:17363900). The Nup107-160 subcomplex is also required for normal kineto

PDB

5A9Q , 7PEQ , 7R5J , 7R5K , 7UHY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	268 → 306	WD domain, G-beta repeat	Repeat
PF00400	WD40	5 → 40	WD domain, G-beta repeat	Repeat

Sequence

MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV
WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK
FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP
MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI
ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG
CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS

Sequence length

360

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Nucleocytoplasmic transport	ISG15 antiviral mechanism
mTOR signaling pathway	Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Amyotrophic lateral sclerosis	Transport of the SLBP independent Mature mRNA
	Transport of the SLBP Dependant Mature mRNA
	Transport of Mature mRNA Derived from an Intronless Transcript
	Transport of Mature mRNA derived from an Intron-Containing Transcript
	Rev-mediated nuclear export of HIV RNA
	Transport of Ribonucleoproteins into the Host Nucleus
	NS1 Mediated Effects on Host Pathways
	Viral Messenger RNA Synthesis
	NEP/NS2 Interacts with the Cellular Export Machinery
	Regulation of Glucokinase by Glucokinase Regulatory Protein
	Vpr-mediated nuclear import of PICs
	snRNP Assembly
	Separation of Sister Chromatids
	Resolution of Sister Chromatid Cohesion
	SUMOylation of DNA damage response and repair proteins
	SUMOylation of ubiquitinylation proteins
	Nuclear Pore Complex (NPC) Disassembly
	Regulation of HSF1-mediated heat shock response
	SUMOylation of SUMOylation proteins
	SUMOylation of chromatin organization proteins
	SUMOylation of RNA binding proteins
	SUMOylation of DNA replication proteins
	Transcriptional regulation by small RNAs
	Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
	RHO GTPases Activate Formins
	tRNA processing in the nucleus
	Mitotic Prometaphase
	HCMV Early Events
	HCMV Late Events
	Postmitotic nuclear pore complex (NPC) reformation
	Amino acids regulate mTORC1
	EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	GWAS catalog	31374203	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tooth agenesis	Uncertain significance	ClinVar Disgenet	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
NUP160	[]	34	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins"]	[]
NUP43	[]	34	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins"]	[]
NUP133	[]	34	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins"]	[]
NUP107	[]	34	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins"]	[]
NUP37	[]	34	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal","Separation of Sister Chromatids","Resolution of Sister Chromatid Cohesion","RHO GTPases Activate Formins","Mitotic Prometaphase","EML4 and NUDC in mitotic spindle formation","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins"]	[]

SEH1L (SEH1 like nucleoporin)

Bookmark This Gene