SEC14L1 (SEC14 like lipid binding 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6397
• Gene name: SEC14 like lipid binding 1
• Gene symbol: SEC14L1
• Synonyms (NCBI Gene): PRELID4A, SEC14L
• Chromosome: 17
• Chromosome location: 17q25.2-q25.3
• Summary: The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternativ

miRNA Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049000	hsa-miR-92a-3p	CLASH	23622248
MIRT044467	hsa-miR-320a	CLASH	23622248
MIRT037755	hsa-miR-708-5p	CLASH	23622248
MIRT036159	hsa-miR-320c	CLASH	23622248
MIRT638302	hsa-let-7c-3p	HITS-CLIP	23824327
MIRT638302	hsa-let-7c-3p	HITS-CLIP	23824327
MIRT1332194	hsa-let-7a	CLIP-seq
MIRT1332195	hsa-let-7b	CLIP-seq
MIRT1332196	hsa-let-7c	CLIP-seq
MIRT1332197	hsa-let-7d	CLIP-seq
MIRT1332198	hsa-let-7e	CLIP-seq
MIRT1332199	hsa-let-7f	CLIP-seq
MIRT1332200	hsa-let-7g	CLIP-seq
MIRT1332201	hsa-let-7i	CLIP-seq
MIRT1332202	hsa-miR-1294	CLIP-seq
MIRT1332203	hsa-miR-202	CLIP-seq
MIRT1332204	hsa-miR-4307	CLIP-seq
MIRT1332205	hsa-miR-4458	CLIP-seq
MIRT1332206	hsa-miR-4500	CLIP-seq
MIRT1332207	hsa-miR-4517	CLIP-seq
MIRT1332208	hsa-miR-556-3p	CLIP-seq
MIRT1332209	hsa-miR-98	CLIP-seq
MIRT1332210	hsa-miR-1263	CLIP-seq
MIRT1332211	hsa-miR-4251	CLIP-seq
MIRT1332212	hsa-miR-4329	CLIP-seq
MIRT1332213	hsa-miR-4786-5p	CLIP-seq
MIRT1332214	hsa-miR-500a	CLIP-seq
MIRT1332215	hsa-miR-501-5p	CLIP-seq
MIRT1332216	hsa-miR-606	CLIP-seq
MIRT1332217	hsa-miR-769-5p	CLIP-seq
MIRT1332194	hsa-let-7a	CLIP-seq
MIRT1332195	hsa-let-7b	CLIP-seq
MIRT1332196	hsa-let-7c	CLIP-seq
MIRT1332197	hsa-let-7d	CLIP-seq
MIRT1332198	hsa-let-7e	CLIP-seq
MIRT1332199	hsa-let-7f	CLIP-seq
MIRT1332200	hsa-let-7g	CLIP-seq
MIRT1332201	hsa-let-7i	CLIP-seq
MIRT1332218	hsa-miR-1252	CLIP-seq
MIRT1332202	hsa-miR-1294	CLIP-seq
MIRT1332203	hsa-miR-202	CLIP-seq
MIRT1332219	hsa-miR-208a	CLIP-seq
MIRT1332220	hsa-miR-208b	CLIP-seq
MIRT1332221	hsa-miR-31	CLIP-seq
MIRT1332222	hsa-miR-3609	CLIP-seq
MIRT1332223	hsa-miR-3617	CLIP-seq
MIRT1332224	hsa-miR-3688-5p	CLIP-seq
MIRT1332204	hsa-miR-4307	CLIP-seq
MIRT1332205	hsa-miR-4458	CLIP-seq
MIRT1332225	hsa-miR-4476	CLIP-seq
MIRT1332206	hsa-miR-4500	CLIP-seq
MIRT1332207	hsa-miR-4517	CLIP-seq
MIRT1332226	hsa-miR-4533	CLIP-seq
MIRT1332227	hsa-miR-499-5p	CLIP-seq
MIRT1332228	hsa-miR-503	CLIP-seq
MIRT1332229	hsa-miR-520d-5p	CLIP-seq
MIRT1332230	hsa-miR-524-5p	CLIP-seq
MIRT1332231	hsa-miR-548ah	CLIP-seq
MIRT1332232	hsa-miR-548c-3p	CLIP-seq
MIRT1332233	hsa-miR-548u	CLIP-seq
MIRT1332208	hsa-miR-556-3p	CLIP-seq
MIRT1332234	hsa-miR-641	CLIP-seq
MIRT1332235	hsa-miR-651	CLIP-seq
MIRT1332209	hsa-miR-98	CLIP-seq
MIRT1332236	hsa-miR-1271	CLIP-seq
MIRT1332237	hsa-miR-182	CLIP-seq
MIRT1332238	hsa-miR-3170	CLIP-seq
MIRT1332239	hsa-miR-3622b-5p	CLIP-seq
MIRT1332240	hsa-miR-3675-3p	CLIP-seq
MIRT1332241	hsa-miR-4642	CLIP-seq
MIRT1332242	hsa-miR-4643	CLIP-seq
MIRT1332243	hsa-miR-96	CLIP-seq
MIRT2618858	hsa-miR-1180	CLIP-seq
MIRT2618859	hsa-miR-1205	CLIP-seq
MIRT2618860	hsa-miR-1207-5p	CLIP-seq
MIRT2618861	hsa-miR-1233	CLIP-seq
MIRT1332236	hsa-miR-1271	CLIP-seq
MIRT2618862	hsa-miR-1286	CLIP-seq
MIRT2618863	hsa-miR-1290	CLIP-seq
MIRT2618864	hsa-miR-129-3p	CLIP-seq
MIRT2618865	hsa-miR-135a	CLIP-seq
MIRT2618866	hsa-miR-135b	CLIP-seq
MIRT2618867	hsa-miR-136	CLIP-seq
MIRT2618868	hsa-miR-139-3p	CLIP-seq
MIRT2618869	hsa-miR-1470	CLIP-seq
MIRT1332237	hsa-miR-182	CLIP-seq
MIRT2618870	hsa-miR-1909	CLIP-seq
MIRT2618871	hsa-miR-2113	CLIP-seq
MIRT2618872	hsa-miR-2277-3p	CLIP-seq
MIRT2618873	hsa-miR-300	CLIP-seq
MIRT1332221	hsa-miR-31	CLIP-seq
MIRT2618874	hsa-miR-3133	CLIP-seq
MIRT2618875	hsa-miR-3157-5p	CLIP-seq
MIRT2618876	hsa-miR-3162-3p	CLIP-seq
MIRT2618877	hsa-miR-3167	CLIP-seq
MIRT2618878	hsa-miR-3168	CLIP-seq
MIRT1332238	hsa-miR-3170	CLIP-seq
MIRT2618879	hsa-miR-3177-3p	CLIP-seq
MIRT2618880	hsa-miR-3192	CLIP-seq
MIRT2618881	hsa-miR-335	CLIP-seq
MIRT1332239	hsa-miR-3622b-5p	CLIP-seq
MIRT2618882	hsa-miR-3689a-3p	CLIP-seq
MIRT2618883	hsa-miR-3689c	CLIP-seq
MIRT2618884	hsa-miR-381	CLIP-seq
MIRT2618885	hsa-miR-423-3p	CLIP-seq
MIRT2618886	hsa-miR-4277	CLIP-seq
MIRT2618887	hsa-miR-4286	CLIP-seq
MIRT2618888	hsa-miR-4290	CLIP-seq
MIRT2618889	hsa-miR-4315	CLIP-seq
MIRT2618890	hsa-miR-4418	CLIP-seq
MIRT2618891	hsa-miR-4436a	CLIP-seq
MIRT2618892	hsa-miR-4446-3p	CLIP-seq
MIRT2618893	hsa-miR-4461	CLIP-seq
MIRT2618894	hsa-miR-4637	CLIP-seq
MIRT1332241	hsa-miR-4642	CLIP-seq
MIRT2618895	hsa-miR-4661-5p	CLIP-seq
MIRT2618896	hsa-miR-4664-3p	CLIP-seq
MIRT2618897	hsa-miR-4666-3p	CLIP-seq
MIRT2618898	hsa-miR-4667-3p	CLIP-seq
MIRT2618899	hsa-miR-4687-5p	CLIP-seq
MIRT2618900	hsa-miR-4707-5p	CLIP-seq
MIRT2618901	hsa-miR-4721	CLIP-seq
MIRT2618902	hsa-miR-4722-5p	CLIP-seq
MIRT2618903	hsa-miR-4728-5p	CLIP-seq
MIRT2618904	hsa-miR-4746-5p	CLIP-seq
MIRT2618905	hsa-miR-4758-3p	CLIP-seq
MIRT2618906	hsa-miR-4763-3p	CLIP-seq
MIRT2618907	hsa-miR-4773	CLIP-seq
MIRT2618908	hsa-miR-486-3p	CLIP-seq
MIRT2618909	hsa-miR-498	CLIP-seq
MIRT2618910	hsa-miR-509-3-5p	CLIP-seq
MIRT2618911	hsa-miR-509-5p	CLIP-seq
MIRT2618912	hsa-miR-604	CLIP-seq
MIRT1332216	hsa-miR-606	CLIP-seq
MIRT2618913	hsa-miR-634	CLIP-seq
MIRT2618914	hsa-miR-647	CLIP-seq
MIRT2618915	hsa-miR-661	CLIP-seq
MIRT2618916	hsa-miR-876-5p	CLIP-seq
MIRT1332243	hsa-miR-96	CLIP-seq
MIRT2618859	hsa-miR-1205	CLIP-seq
MIRT2618860	hsa-miR-1207-5p	CLIP-seq
MIRT2618861	hsa-miR-1233	CLIP-seq
MIRT1332236	hsa-miR-1271	CLIP-seq
MIRT2618862	hsa-miR-1286	CLIP-seq
MIRT2618863	hsa-miR-1290	CLIP-seq
MIRT2618864	hsa-miR-129-3p	CLIP-seq
MIRT2618865	hsa-miR-135a	CLIP-seq
MIRT2618866	hsa-miR-135b	CLIP-seq
MIRT2618867	hsa-miR-136	CLIP-seq
MIRT2618868	hsa-miR-139-3p	CLIP-seq
MIRT2618869	hsa-miR-1470	CLIP-seq
MIRT1332237	hsa-miR-182	CLIP-seq
MIRT2618870	hsa-miR-1909	CLIP-seq
MIRT2618871	hsa-miR-2113	CLIP-seq
MIRT2618872	hsa-miR-2277-3p	CLIP-seq
MIRT2618873	hsa-miR-300	CLIP-seq
MIRT1332221	hsa-miR-31	CLIP-seq
MIRT2618874	hsa-miR-3133	CLIP-seq
MIRT2618875	hsa-miR-3157-5p	CLIP-seq
MIRT2618876	hsa-miR-3162-3p	CLIP-seq
MIRT2618877	hsa-miR-3167	CLIP-seq
MIRT1332238	hsa-miR-3170	CLIP-seq
MIRT2618880	hsa-miR-3192	CLIP-seq
MIRT2618881	hsa-miR-335	CLIP-seq
MIRT1332239	hsa-miR-3622b-5p	CLIP-seq
MIRT2618882	hsa-miR-3689a-3p	CLIP-seq
MIRT2618883	hsa-miR-3689c	CLIP-seq
MIRT2618884	hsa-miR-381	CLIP-seq
MIRT2618885	hsa-miR-423-3p	CLIP-seq
MIRT2618887	hsa-miR-4286	CLIP-seq
MIRT2618888	hsa-miR-4290	CLIP-seq
MIRT2618890	hsa-miR-4418	CLIP-seq
MIRT2690313	hsa-miR-4424	CLIP-seq
MIRT2618891	hsa-miR-4436a	CLIP-seq
MIRT2618892	hsa-miR-4446-3p	CLIP-seq
MIRT2618893	hsa-miR-4461	CLIP-seq
MIRT2618894	hsa-miR-4637	CLIP-seq
MIRT1332241	hsa-miR-4642	CLIP-seq
MIRT2618895	hsa-miR-4661-5p	CLIP-seq
MIRT2618897	hsa-miR-4666-3p	CLIP-seq
MIRT2618898	hsa-miR-4667-3p	CLIP-seq
MIRT2618899	hsa-miR-4687-5p	CLIP-seq
MIRT2618900	hsa-miR-4707-5p	CLIP-seq
MIRT2618901	hsa-miR-4721	CLIP-seq
MIRT2618902	hsa-miR-4722-5p	CLIP-seq
MIRT2618903	hsa-miR-4728-5p	CLIP-seq
MIRT2618904	hsa-miR-4746-5p	CLIP-seq
MIRT2690314	hsa-miR-4757-5p	CLIP-seq
MIRT2618905	hsa-miR-4758-3p	CLIP-seq
MIRT2618906	hsa-miR-4763-3p	CLIP-seq
MIRT2618907	hsa-miR-4773	CLIP-seq
MIRT2618908	hsa-miR-486-3p	CLIP-seq
MIRT2618909	hsa-miR-498	CLIP-seq
MIRT2618910	hsa-miR-509-3-5p	CLIP-seq
MIRT2618911	hsa-miR-509-5p	CLIP-seq
MIRT2618912	hsa-miR-604	CLIP-seq
MIRT1332216	hsa-miR-606	CLIP-seq
MIRT2618913	hsa-miR-634	CLIP-seq
MIRT2618914	hsa-miR-647	CLIP-seq
MIRT2618915	hsa-miR-661	CLIP-seq
MIRT2618916	hsa-miR-876-5p	CLIP-seq
MIRT1332243	hsa-miR-96	CLIP-seq
MIRT2618864	hsa-miR-129-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	16125763
GO:0005515	Function	Protein binding	IPI	17092608, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	23843640
GO:0005737	Component	Cytoplasm	IDA	23843640
GO:0005737	Component	Cytoplasm	IDA	17092608
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	17092608
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0015871	Process	Choline transport	IDA	17092608
GO:0039532	Process	Negative regulation of cytoplasmic pattern recognition receptor signaling pathway	IDA	23843640
GO:0039536	Process	Negative regulation of RIG-I signaling pathway	IBA
GO:0039536	Process	Negative regulation of RIG-I signaling pathway	IMP	23843640
GO:0039552	Function	RIG-I binding	IBA
GO:0039552	Function	RIG-I binding	IPI	23843640
GO:0045087	Process	Innate immune response	IEA
GO:0140311	Function	Protein sequestering activity	IDA	23843640

Other IDs

• MIM: 601504
• HGNC: 10698
• e!Ensembl: ENSG00000129657

Protein

• UniProt ID: Q92503
• Protein name: SEC14-like protein 1
• Protein function: May play a role in innate immunity by inhibiting the antiviral RIG-I signaling pathway. In this pathway, functions as a negative regulator of RIGI, the cytoplasmic sensor of viral nucleic acids. Prevents the interaction of RIGI with MAVS/IPS1, a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00650	CRAL_TRIO	321 → 490	CRAL/TRIO domain	Domain
  PF03765	CRAL_TRIO_N	251 → 299	CRAL/TRIO, N-terminal domain	Domain
  PF04707	PRELI	17 → 173	PRELI-like family	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:8697811}.
• Sequence:

  MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCK
  LDVDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPEN
  EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
  WSPPSITTSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDDKLD
  ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
  SLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGE
  EALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
  VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDK
  EIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILI
  QIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQ
  LGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQ
  VSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISR

• Sequence length: 715

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monoclonal B-Cell Lymphocytosis	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	35893037	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	29955149		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29955149	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11707779	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29955149	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29955149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23083832, 25701228		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25701228		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11707779, 25701228		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11707779		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11707779	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23083832		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	11707779		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	11707779	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for SEC14L1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to SEC14L1.