SEC11B (SEC11 homolog B, signal peptidase complex subunit (pseudogene))

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 157708
Gene name SEC11 homolog B, signal peptidase complex subunit (pseudogene)
Gene symbol SEC11B
Synonyms (NCBI Gene)
SEC11L2SPCS4B
Chromosome 8
Chromosome location 8q11.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0005787 Component Signal peptidase complex IBA
GO:0005787 Component Signal peptidase complex IEA
GO:0006465 Process Signal peptide processing IBA
GO:0006465 Process Signal peptide processing IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31884 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0C7V7
Protein name Putative signal peptidase complex catalytic subunit SEC11B (EC 3.4.21.89) (SEC11 homolog B) (SEC11-like protein 2)
Protein function Putative component of some signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00717 Peptidase_S24 15 → 129 Peptidase S24-like Domain
Sequence 
MNKWRLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVLLSGSMEPAFHRGYLLFLTNRV
EDPIRVGEIAVLRIEGRKIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQDQHWL
EKKDVVGRARGFVPYIGIGTSLMNDYPKHKYEVLFLLGLFVLVHRE
Sequence length 166
Interactions View interactions

No strongly related genes found yet for SEC11B.

No additional diseases found yet through genes similar to SEC11B.