SEBOX (SEBOX homeobox)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 645832
Gene name SEBOX homeobox
Gene symbol SEBOX
Synonyms (NCBI Gene)
OG-9OG9OG9X
Chromosome 17
Chromosome location 17q11.2
Summary Homeodomain proteins, such as SEBOX, play a key role in coordinating gene expression during development (Cinquanta et al., 2000 [PubMed 10922053]).[supplied by OMIM, Mar 2008]
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005634 Component Nucleus IEA
GO:0006357 Process Regulation of transcription by RNA polymerase II NAS 34673265
GO:0009792 Process Embryo development ending in birth or egg hatching IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610975 32942 ENSG00000274529
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HB31
Protein name Homeobox protein SEBOX (Homeobox OG-9) (Skin-, embryo-, brain- and oocyte-specific homeobox)
Protein function Probable transcription factor involved in the control of specification of mesoderm and endoderm.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 20 → 76 Homeodomain Domain
Sequence 
MPSPVDASSADGGSGLGSHRRKRTTFSKGQLLELERAFAAWPYPNISTHEHLAWVTCLPE
AKVQVWFQKRWAKIIKNRKSGILSPGSECPQSSCSLPDTLQQPWDPQMPGQPPPSSGTPQ
RTSVCRHSSCPAPGLSPRQGWEGAKAVAPWGSAGASEVHPSLERATPQTSLGSLSDLIYA
LAIVVNVDHS
Sequence length 190
Interactions View interactions

No strongly related genes found yet for SEBOX.

No additional diseases found yet through genes similar to SEBOX.